2JZ3: SOCS box elonginBC ternary complex

SOCS box elonginBC ternary complex. Determined by solution NMR. Released 23 Sept 2008.

Method: Solution NMR
Organisms: Mus musculus, Homo sapiens
Chains: 3
Atoms: 1,797
Mol. weight: 28.56 kDa
Released: 23 Sept 2008

Explore 2JZ3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JZ3 contains 8 α-helices and 9 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-14	11

Chain B: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
β-strand	12-19	8	1
α-helix	24-34	11
β-strand	43-46	4	1
α-helix	57-60	4
β-strand	73-78	6	1

Chain C: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	18-22	5	1
β-strand	28-32	5	1
α-helix	33-36	4
α-helix	37-39	3
α-helix	42-47	6
β-strand	59-61	3	1
α-helix	67-83	17
β-strand	96	1	2
β-strand	99	1	2
α-helix	101-109	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Suppressor of cytokine signaling 3	A	protein	40	Mus musculus	O35718 (AlphaFold model)
Transcription elongation factor B polypeptide 2	B	protein	118	Homo sapiens	Q15370 (AlphaFold model)
Transcription elongation factor B polypeptide 1	C	protein	96	Mus musculus	P83940 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JZ3_1 Suppressor of cytokine signaling 3 (chains A)
VATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL

Sequence of entity 2 (B), FASTA

>2JZ3_2 Transcription elongation factor B polypeptide 2 (chains B)
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ

Sequence of entity 3 (C), FASTA

>2JZ3_3 Transcription elongation factor B polypeptide 1 (chains C)
MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMY
FTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Primary citation

The SOCS box domain of SOCS3: structure and interaction with the elonginBC-cullin5 ubiquitin ligase. Babon, J.J., Sabo, J.K., Soetopo, A. et al. J Mol Biol (2008) 381:928-940. DOI 10.1016/j.jmb.2008.06.038 · PubMed

Other PDB entries of the same protein (UniProt O35718 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HMH 2.0 Å, Crystal structure of SOCS3 in complex with gp130(pTyr757) phosphopeptide.
4GL9 3.9 Å, Crystal structure of inhibitory protein SOCS3 in complex with JAK2 kinase domain and…
2BBU solution structure of mouse socs3 in complex with a phosphopeptide from the gp130 receptor

Browse structure collections

About this viewer

MolViewer shows 2JZ3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.