2HQE: Human P100 Tudor domain: Large fragment

Crystal structure of human P100 Tudor domain: Large fragment. Determined by X-ray diffraction at 2.0 Å resolution. Released 3 Jul 2007.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,591
Mol. weight: 55.88 kDa
Released: 3 Jul 2007

Explore 2HQE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HQE contains 15 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	658-665	8	1
β-strand	670-675	6	1
α-helix	676-678	3
α-helix	679-695	17
α-helix	697-699	3
β-strand	710-714	5	2
β-strand	720-730	11	2
β-strand	733-738	6	2
β-strand	744-747	4	2
α-helix	749-751	3
β-strand	752-753	2	2
α-helix	757-759	3
β-strand	769-773	5	1
β-strand	776-777	2	3
α-helix	778-779	2
α-helix	782-796	15
β-strand	799-807	9	1
α-helix	813	1
β-strand	814-818	5	1
β-strand	825	1	1
α-helix	826-832	7
β-strand	837-838	2	3
α-helix	844-846	3
α-helix	847-862	16
α-helix	866-868	3

Chain B: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	681-695	15
β-strand	710-714	5	4
β-strand	720-730	11	4
β-strand	733-738	6	4
β-strand	744-747	4	4
α-helix	749-751	3
β-strand	752-753	2	4
α-helix	757-759	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
P100 Co-activator tudor domain	A, B	protein	246	Homo sapiens	Q7KZF4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2HQE_1 P100 Co-activator tudor domain (chains A, B)
PVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQDVETGTQFQKLMENMRNDIASHPPV
EGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTLSPAF
STRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEHLSAGCPHVTLQF
ADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRADDAD
EFGYSR

Primary citation

Crystal Structure of a large fragment of the Human P100 Tudor Domain. Shah, N., Zhao, M., Cheng, C. et al. To be published.

Other PDB entries of the same protein (UniProt Q7KZF4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HQX 1.42 Å, Crystal structure of human P100 tudor domain conserved region
5M9O 1.45 Å, Crystal structure of human SND1 extended Tudor domain in complex with a symmetrically…
3OMC 1.77 Å, Structure of human SND1 extended tudor domain in complex with the symmetrically…
3OMG 1.85 Å, Structure of human SND1 extended tudor domain in complex with the symmetrically…
3BDL 1.9 Å, Crystal structure of a truncated human Tudor-SN
2O4X 2.0 Å, Crystal structure of human P100 tudor domain
7KNW 2.65 Å, Crystal structure of SND1 in complex with C-26-A2
7KNX 2.7 Å, Crystal structure of SND1 in complex with C-26-A6
4QMG 2.7 Å, The Structure of MTDH-SND1 Complex Reveals Novel Cancer-Promoting Interactions
2E6N Solution structure of the TUDOR domain of Staphylococcal nuclease domain-containing…

Browse structure collections

About this viewer

MolViewer shows 2HQE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.