2HT0: IHF

IHF bound to doubly nicked DNA. Determined by X-ray diffraction at 2.0 Å resolution. Released 28 Nov 2006.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Escherichia coli
Chains: 6
Atoms: 3,224
Mol. weight: 43.6 kDa
Ligands: CD
Released: 28 Nov 2006

Explore 2HT0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HT0 contains 6 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
α-helix	5-16	12
α-helix	20-39	20
β-strand	44-46	3	2
β-strand	50-57	8	2
β-strand	60	1	3
β-strand	73	1	3
β-strand	76-83	8	2
α-helix	85-91	7

Chain B: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	2
α-helix	3-13	11
α-helix	19-38	20
β-strand	43-45	3	1
β-strand	49-56	8	1
β-strand	59-62	4	4
β-strand	69-72	4	4
β-strand	75-82	8	1
α-helix	84-90	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(cpgpgptpgpcpapapcpapapap*t)-3'	C	DNA	13
5'-d(tpgpaptpapapgpcpapaptpgpcptptptptptptpgpgpc)-3'	D	DNA	22
5'-d(gpgpcpcpapapapapapapgpcpaptp*t)-3'	E	DNA	15
5'-d(gpcptptpaptpcpapaptptptpgptptpgpcpapcpc)-3'	F	DNA	20
Integration host factor alpha-subunit	A	protein	99	Escherichia coli	P0A6X7 (AlphaFold model)
Integration host factor beta-subunit	B	protein	94	Escherichia coli	P0A6Y1 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>2HT0_1 5'-D(*CP*GP*GP*TP*GP*CP*AP*AP*CP*AP*AP*AP*T)-3' (chains C)
CGGTGCAACAAAT

Sequence of entity 2 (D), FASTA

>2HT0_2 5'-D(*TP*GP*AP*TP*AP*AP*GP*CP*AP*AP*TP*GP*CP*TP*TP*TP*TP*TP*TP*GP*GP*C)-3' (chains D)
TGATAAGCAATGCTTTTTTGGC

Sequence of entity 3 (E), FASTA

>2HT0_3 5'-D(*GP*GP*CP*CP*AP*AP*AP*AP*AP*AP*GP*CP*AP*TP*T)-3' (chains E)
GGCCAAAAAAGCATT

Sequence of entity 4 (F), FASTA

>2HT0_4 5'-D(*GP*CP*TP*TP*AP*TP*CP*AP*AP*TP*TP*TP*GP*TP*TP*GP*CP*AP*CP*C)-3' (chains F)
GCTTATCAATTTGTTGCACC

Sequence of entity 5 (A), FASTA

>2HT0_5 Integration host factor alpha-subunit (chains A)
MALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQR
PGRNPKTGEDIPITARRVVTFRPGQKLKSRVENASPKDE

Sequence of entity 6 (B), FASTA

>2HT0_6 Integration host factor beta-subunit (chains B)
MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRT
GRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

Ligands and cofactors

ID	Name	Formula	Copies
CD	Cadmium ion	Cd	1

Primary citation

Structure-based Analysis of HU-DNA Binding. Swinger, K.K., Rice, P.A. J Mol Biol (2007) 365:1005-1016. DOI 10.1016/j.jmb.2006.10.024 · PubMed

Other PDB entries of the same protein (UniProt P0A6X7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1OWF 1.95 Å, Crystal structure of a mutant IHF (BetaE44A) complexed with the native H' Site
1OWG 2.1 Å, Crystal structure of WT IHF complexed with an altered H' site (T44A)
1OUZ 2.41 Å, Crystal structure of a mutant IHF (BetaE44A) complexed with a variant H' Site (T44A)
2IIE 2.41 Å, single chain Integration Host Factor protein (scIHF2) in complex with DNA
1IHF 2.5 Å, Integration host factor/dna complex
2IIF 2.72 Å, single chain Integration Host Factor mutant protein (scIHF2-K45aE) in complex with DNA
9F10 2.94 Å, CryoEM structure of the F plasmid relaxosome with TraI in its TE mode, without accessory…
9F0Z 3.42 Å, CryoEM structure of the F plasmid relaxosome with truncated TraI1-863 in its TE mode,…
9F12 3.42 Å, CryoEM structure of the F plasmid relaxosome with oriT DNA ss-27_-3ds-2_+143 and TraI…
9F0Y 3.45 Å, CryoEM structure of the F plasmid relaxosome with TraI in its TE mode, derived from the…
5WFE 3.64 Å, Cas1-Cas2-IHF-DNA holo-complex
9F11 3.68 Å, CryoEM structure of the F plasmid relaxosome with oriT DNA ss-27_+3ds+4_+143 and TraI…

Browse structure collections

About this viewer

MolViewer shows 2HT0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.