2HTY: N1 neuraminidase

N1 neuraminidase. Determined by X-ray diffraction at 2.5 Å resolution. Released 5 Sept 2006.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Influenza A virus
Chains: 8
Atoms: 24,458
Mol. weight: 341.52 kDa
Ligands: NDG, CA, NAG
Released: 5 Sept 2006

Explore 2HTY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HTY contains 62 α-helices and 225 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	84-86	3
β-strand	91	1	1
α-helix	92-93	2
β-strand	98-102	5	2
α-helix	105-109	5
α-helix	114	1
β-strand	115-124	10	3
β-strand	129-139	11	3
α-helix	143-145	3
β-strand	157-162	6	3
α-helix	171	1
β-strand	172-176	5	3
β-strand	179-184	6	4
β-strand	189-195	7	4
β-strand	202-207	6	4
β-strand	210-216	7	4
β-strand	224-225	2	5
β-strand	229	1	4
β-strand	231-233	3	5
β-strand	236-243	8	5
β-strand	251-258	8	5
β-strand	261-267	7	5
β-strand	279-283	5	6
β-strand	286-290	5	6
α-helix	300	1
β-strand	301-305	5	6
β-strand	312-316	5	6
β-strand	353-356	4	7
β-strand	359-364	6	7
β-strand	372-379	8	7
β-strand	392-403	11	7
β-strand	407-412	6	2
α-helix	412B-413	4
β-strand	418	1	1
β-strand	419-429	11	2
β-strand	439-447	9	2

Chain B: 9 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	84-86	3
α-helix	90	1
β-strand	91	1	8
α-helix	92-93	2
β-strand	98-102	5	9
α-helix	105-109	5
β-strand	115-118	4	10
β-strand	122-124	3	10
β-strand	129-139	11	10
α-helix	143-145	3
β-strand	157-162	6	10
α-helix	166-167	2
α-helix	171	1
β-strand	172-176	5	10
β-strand	179-184	6	11
β-strand	189-195	7	11
β-strand	202-207	6	11
β-strand	210-216	7	11
β-strand	224	1	12
β-strand	231-233	3	12
β-strand	236-243	8	12
β-strand	251-258	8	12
β-strand	261-267	7	12
β-strand	279-283	5	13
β-strand	286-290	5	13
α-helix	300	1
β-strand	301-305	5	13
β-strand	312-316	5	13
β-strand	353-356	4	14
β-strand	359-364	6	14
β-strand	372-379	8	14
β-strand	392-403	11	14
β-strand	407-412	6	9
α-helix	412B-413	4
β-strand	418	1	8
β-strand	419-429	11	9
β-strand	439-447	9	9

Chain C: 8 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	84-86	3
β-strand	91	1	15
α-helix	92-93	2
β-strand	98-102	5	16
α-helix	105-108	4
β-strand	115-118	4	17
β-strand	122-124	3	17
β-strand	129-139	11	17
α-helix	143-145	3
β-strand	157-162	6	17
α-helix	171	1
β-strand	172-176	5	17
β-strand	179-184	6	18
β-strand	189-195	7	18
α-helix	198-200	3
β-strand	202-207	6	18
β-strand	210-216	7	18
β-strand	224	1	19
β-strand	231-233	3	19
β-strand	236-243	8	19
β-strand	251-258	8	19
β-strand	261-267	7	19
β-strand	276-283	8	20
β-strand	286-292	7	20
α-helix	300	1
β-strand	301-305	5	20
β-strand	312-316	5	20
β-strand	353-356	4	21
β-strand	359-364	6	21
β-strand	372-379	8	21
β-strand	392-403	11	21
β-strand	407-411	5	16
α-helix	412A-413	5
β-strand	418	1	15
β-strand	420-429	10	16
β-strand	439-447	9	16

Chain D: 4 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	91	1	22
α-helix	92-93	2
β-strand	98-102	5	23
α-helix	105-109	5
β-strand	115-118	4	24
β-strand	122-124	3	24
β-strand	129-139	11	24
α-helix	143-145	3
β-strand	157-162	6	24
β-strand	172-176	5	24
β-strand	179-184	6	25
β-strand	189-195	7	25
β-strand	202-207	6	25
β-strand	210-216	7	25
β-strand	224	1	26
β-strand	231-233	3	26
β-strand	236-243	8	26
β-strand	251-258	8	26
β-strand	261-267	7	26
β-strand	279-283	5	27
β-strand	286-290	5	27
β-strand	301-305	5	27
β-strand	312-316	5	27
β-strand	353-356	4	28
β-strand	359-364	6	28
β-strand	372-379	8	28
β-strand	392-403	11	28
β-strand	407-412	6	23
α-helix	412B-413	4
β-strand	418	1	22
β-strand	419-429	11	23
β-strand	439-447	9	23

Chain E: 10 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	84-86	3
α-helix	90	1
β-strand	91	1	29
α-helix	92-93	2
β-strand	98-102	5	30
α-helix	105-109	5
β-strand	115-118	4	31
β-strand	122-124	3	31
β-strand	129-139	11	31
α-helix	143-145	3
β-strand	157-162	6	31
α-helix	166-167	2
α-helix	171	1
β-strand	172-176	5	31
β-strand	179-184	6	32
β-strand	189-195	7	32
β-strand	202-207	6	32
β-strand	210-216	7	32
β-strand	224-225	2	33
β-strand	228-229	2	32
β-strand	231-233	3	33
β-strand	236-243	8	33
β-strand	251-258	8	33
β-strand	261-267	7	33
β-strand	276-283	8	34
β-strand	286-292	7	34
α-helix	300	1
β-strand	301-305	5	34
β-strand	312-316	5	34
β-strand	352-356	5	35
β-strand	359-364	6	35
β-strand	372-379	8	35
β-strand	392-403	11	35
β-strand	407-411	5	30
α-helix	412B-413	4
β-strand	418	1	29
α-helix	419	1
β-strand	420-429	10	30
β-strand	439-447	9	30

Chain F: 8 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	90	1
β-strand	91	1	36
α-helix	92-93	2
β-strand	98-102	5	37
α-helix	105-108	4
β-strand	115-118	4	38
β-strand	122-124	3	38
β-strand	129-139	11	38
α-helix	143-145	3
β-strand	157-162	6	38
α-helix	166-167	2
α-helix	171	1
β-strand	172-176	5	38
β-strand	180-184	5	39
β-strand	189-195	7	39
β-strand	202-207	6	39
β-strand	210-216	7	39
β-strand	224-225	2	40
β-strand	231-233	3	40
β-strand	236-243	8	40
β-strand	251-258	8	40
β-strand	261-267	7	40
β-strand	279-283	5	41
β-strand	286-290	5	41
α-helix	300	1
β-strand	301-305	5	41
β-strand	312-316	5	41
β-strand	352-356	5	42
β-strand	359-364	6	42
β-strand	372-379	8	42
β-strand	392-403	11	42
β-strand	407-412	6	37
α-helix	412B-413	4
β-strand	418	1	36
β-strand	419-429	11	37
β-strand	439-447	9	37

Chain G: 8 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	84-86	3
α-helix	90	1
β-strand	91	1	43
α-helix	92-93	2
β-strand	98-102	5	44
α-helix	105-108	4
β-strand	115-118	4	45
β-strand	122-124	3	45
β-strand	129-139	11	45
α-helix	143-146	4
β-strand	157-162	6	45
α-helix	171	1
β-strand	172-176	5	45
β-strand	179-184	6	46
β-strand	189-195	7	46
β-strand	202-207	6	46
β-strand	210-216	7	46
β-strand	224	1	47
β-strand	231-233	3	47
β-strand	236-243	8	47
β-strand	251-258	8	47
β-strand	261-267	7	47
β-strand	279-283	5	48
β-strand	286-290	5	48
α-helix	300	1
β-strand	301-305	5	48
β-strand	312-316	5	48
β-strand	353-356	4	49
β-strand	359-364	6	49
β-strand	372-379	8	49
β-strand	392-403	11	49
β-strand	407-412	6	44
α-helix	412B-413	4
β-strand	418	1	43
β-strand	419-429	11	44
β-strand	439-447	9	44

Chain H: 7 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	84-86	3
α-helix	90	1
β-strand	91	1	50
α-helix	92-93	2
β-strand	98-102	5	51
α-helix	105-108	4
β-strand	115-118	4	52
β-strand	122-124	3	52
β-strand	129-139	11	52
α-helix	143-145	3
β-strand	157-162	6	52
α-helix	171	1
β-strand	172-176	5	52
β-strand	179-184	6	53
β-strand	189-195	7	53
β-strand	202-207	6	53
β-strand	210-216	7	53
β-strand	224-225	2	54
β-strand	231-233	3	54
β-strand	236-243	8	54
β-strand	251-258	8	54
β-strand	261-267	7	54
β-strand	279-283	5	55
β-strand	286-290	5	55
β-strand	301-305	5	55
β-strand	312-316	5	55
β-strand	353-356	4	56
β-strand	359-364	6	56
β-strand	372-379	8	56
β-strand	392-403	11	56
β-strand	407-412	6	51
α-helix	412B-413	4
β-strand	418	1	50
β-strand	419-429	11	51
β-strand	439-447	9	51

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neuraminidase	A, B, C, D, E, F, G, H	protein	387	Influenza A virus	Q6DPL2

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>2HTY_1 Neuraminidase (chains A, B, C, D, E, F, G, H)
VKLAGNSSLCPINGWAVYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLND
KHSNGTVKDRSPHRTLMSCPVGEAPSPYNSRFESVAWSASACHDGTSWLTIGISGPDNGA
VAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFKMEKGK
VVKSVELDAPNYHYEECSCYPNAGEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGVF
GDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIGRTKSTNSRSGFEMIWDPNGWTE
TDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKESTIWTSGSS
ISFCGVNSDTVGWSWPDGAELPFTIDK

Ligands and cofactors

ID	Name	Formula	Copies
NDG	2-acetamido-2-deoxy-alpha-D-glucopyranose	C8 H15 N O6	7
CA	Calcium ion	Ca	8
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

The structure of H5N1 avian influenza neuraminidase suggests new opportunities for drug design. Russell, R.J., Haire, L.F., Stevens, D.J. et al. Nature (2006) 443:45-49. DOI 10.1038/nature05114 · PubMed

Other PDB entries of the same protein (UniProt Q6DPL2), best resolution first:

3CKZ 1.9 Å, N1 Neuraminidase H274Y + Zanamivir
3CL0 2.2 Å, N1 Neuraminidase H274Y + oseltamivir
9NJ2 2.4 Å, N1 neuraminidase of influenza A/Vietnam/1203/2004 H5N1 in complex with four FNI9 Fab…
2HU4 2.5 Å, N1 neuraminidase in complex with oseltamivir 2
3CL2 2.54 Å, N1 Neuraminidase N294S + Oseltamivir
2HU0 2.95 Å, N1 neuraminidase in complex with oseltamivir 1

Browse structure collections

About this viewer

MolViewer shows 2HTY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.