2HV8: GTP-bound Rab11
Crystal structure of GTP-bound Rab11 in complex with FIP3. Determined by X-ray diffraction at 1.86 Å resolution. Released 21 Nov 2006.
- Method
- X-ray diffraction
- Resolution
- 1.86 Å
- Organism
- Homo sapiens
- Chains
- 6
- Atoms
- 6,119
- Mol. weight
- 81.82 kDa
- Ligands
- 2ME, GTP, MG
- Released
- 21 Nov 2006
Explore 2HV8 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
2HV8 contains 29 α-helices and 21 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 6 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 10-17 | 8 | 1 |
| α-helix | 24-33 | 10 | |
| β-strand | 46-55 | 10 | 1 |
| β-strand | 58-67 | 10 | 1 |
| α-helix | 77-81 | 5 | |
| β-strand | 86-92 | 7 | 1 |
| α-helix | 96-100 | 5 | |
| α-helix | 102-112 | 11 | |
| β-strand | 118-124 | 7 | 1 |
| α-helix | 136-145 | 10 | |
| β-strand | 149-152 | 4 | 1 |
| α-helix | 161-174 | 14 | |
Chain B: 7 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 10-17 | 8 | 2 |
| α-helix | 24-33 | 10 | |
| β-strand | 46-55 | 10 | 2 |
| β-strand | 58-67 | 10 | 2 |
| α-helix | 77-81 | 5 | |
| β-strand | 86-92 | 7 | 2 |
| α-helix | 96-100 | 5 | |
| α-helix | 102-112 | 11 | |
| β-strand | 118-124 | 7 | 2 |
| α-helix | 126-131 | 6 | |
| α-helix | 136-145 | 10 | |
| β-strand | 149-152 | 4 | 2 |
| α-helix | 161-174 | 14 | |
Chain C: 7 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 10-17 | 8 | 3 |
| α-helix | 24-33 | 10 | |
| β-strand | 46-55 | 10 | 3 |
| β-strand | 58-67 | 10 | 3 |
| α-helix | 77-81 | 5 | |
| β-strand | 86-92 | 7 | 3 |
| α-helix | 96-100 | 5 | |
| α-helix | 102-112 | 11 | |
| β-strand | 118-124 | 7 | 3 |
| α-helix | 129-131 | 3 | |
| α-helix | 136-145 | 10 | |
| β-strand | 149-152 | 4 | 3 |
| α-helix | 161-174 | 14 | |
Chain D: 3 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 704-709 | 6 | |
| α-helix | 717-746 | 30 | |
| α-helix | 750-753 | 4 | |
| β-strand | 754 | 1 | 1 |
Chain E: 4 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 703-713 | 11 | |
| α-helix | 715-716 | 2 | |
| α-helix | 717-748 | 32 | |
| α-helix | 750-753 | 4 | |
| β-strand | 754 | 1 | 2 |
Chain F: 2 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 717-746 | 30 | |
| α-helix | 750-753 | 4 | |
| β-strand | 754 | 1 | 3 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Ras-related protein Rab-11A | A, B, C | protein | 172 | Homo sapiens | P62491 (AlphaFold model) |
| Rab11 family-interacting protein 3 | D, E, F | protein | 64 | Homo sapiens | O75154 (AlphaFold model) |
Sequence of entity 1 (A, B, C), FASTA
>2HV8_1 Ras-related protein Rab-11A (chains A, B, C)
GSDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQ
IWDTAGLERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVG
NKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRI
Sequence of entity 2 (D, E, F), FASTA
>2HV8_2 Rab11 family-interacting protein 3 (chains D, E, F)
GSGAKSLFSTAFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAIMETNPSI
LEVK
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| 2ME | Methoxyethane | C3 H8 O | 1 |
| GTP | Guanosine-5'-triphosphate | C10 H16 N5 O14 P3 | 3 |
| MG | Magnesium ion | Mg | 3 |
Water and common crystallization additives (MES, SO4) are not listed.
Primary citation
Structural Basis for Rab11-mediated Recruitment of FIP3 to Recycling Endosomes. Eathiraj, S., Mishra, A., Prekeris, R. et al. J Mol Biol (2006) 364:121-135. DOI 10.1016/j.jmb.2006.08.064 · PubMed
Other PDB entries of the same protein (UniProt P62491 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1OIX 1.7 Å, X-ray structure of the small G protein Rab11a in complex with GDP and Pi
- 2D7C 1.75 Å, Crystal structure of human Rab11 in complex with FIP3 Rab-binding domain
- 1OIV 1.98 Å, X-ray structure of the small G protein Rab11a in complex with GDP
- 1YZK 2.0 Å, GppNHp bound Rab11 GTPase
- 4C4P 2.0 Å, Crystal Structure of Wild-Type Rab11 Complexed to FIP2
- 1OIW 2.05 Å, X-ray structure of the small G protein Rab11a in complex with GTPgammaS
- 5JCZ 2.06 Å, Rab11 bound to MyoVa-GTD
- 6IY1 2.11 Å, Structure of human Ras-related protein Rab11
- 4LX0 2.19 Å, Crystal structure of Myo5b globular tail domain in complex with active Rab11a
- 5EZ5 2.4 Å, Crystal structure of active Rab11A (S20V) in complex with GTP
- 2GZD 2.44 Å, Crystal Structure of Rab11 in Complex with Rab11-FIP2
- 2GZH 2.47 Å, Crystal Structure of Rab11 in Complex with Rab11-Family Interacting Protein 2
Browse structure collections
About this viewer
MolViewer shows 2HV8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.