Crystal structure of S-nitroso thioredoxin. Determined by X-ray diffraction at 1.65 Å resolution. Released 5 Dec 2006.
Explore 2HXK in 3D Show helices and sheets RCSB PDB PDBe
2HXK contains 14 α-helices and 17 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-5 | 3 | 1 |
| α-helix | 8-17 | 10 | |
| β-strand | 23-28 | 6 | 1 |
| α-helix | 33-48 | 16 | |
| β-strand | 53-58 | 6 | 1 |
| α-helix | 63-68 | 6 | |
| β-strand | 73 | 1 | 2 |
| β-strand | 76-81 | 6 | 1 |
| β-strand | 84-90 | 7 | 1 |
| α-helix | 94-104 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-4 | 3 | 3 |
| α-helix | 5 | 1 | |
| α-helix | 8-17 | 10 | |
| β-strand | 23-28 | 6 | 3 |
| α-helix | 33-48 | 16 | |
| β-strand | 53-58 | 6 | 3 |
| α-helix | 63-68 | 6 | |
| β-strand | 73 | 1 | 2 |
| β-strand | 76-81 | 6 | 3 |
| β-strand | 84-90 | 7 | 3 |
| α-helix | 94-104 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2 | 1 | |
| β-strand | 3-4 | 2 | 4 |
| α-helix | 8-16 | 9 | |
| β-strand | 23-28 | 6 | 4 |
| α-helix | 33-48 | 16 | |
| β-strand | 53-58 | 6 | 4 |
| α-helix | 63-68 | 6 | |
| β-strand | 76-81 | 6 | 4 |
| β-strand | 84-90 | 7 | 4 |
| α-helix | 94-104 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Thioredoxin | A, B, C | protein | 105 | Homo sapiens | P10599 (AlphaFold model) |
>2HXK_1 Thioredoxin (chains A, B, C) MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
| ID | Name | Formula | Copies |
|---|---|---|---|
| EOH | Ethanol | C2 H6 O | 3 |
Buried s-nitrosocysteine revealed in crystal structures of human thioredoxin. Weichsel, A., Brailey, J.L., Montfort, W.R. Biochemistry (2007) 46:1219-1227. DOI 10.1021/bi061878r · PubMed
Other PDB entries of the same protein (UniProt P10599 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2HXK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.