2HZ5: Human dynein light chain Dnlc2A

Crystal structure of human dynein light chain Dnlc2A. Determined by X-ray diffraction at 2.1 Å resolution. Released 14 Aug 2007.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,525
Mol. weight: 24.32 kDa
Ligands: CS
Released: 14 Aug 2007

Explore 2HZ5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HZ5 contains 4 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	6-12	7
β-strand	17-23	7	1
β-strand	29-32	4	1
α-helix	36-60	25
β-strand	66-73	8	1
β-strand	77-81	5	1
β-strand	87-92	6	1

Chain B: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	9-12	4
β-strand	17-23	7	1
β-strand	29-32	4	1
α-helix	36-60	25
β-strand	66-73	8	1
β-strand	77-82	6	1
β-strand	87-92	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dynein light chain 2A, cytoplasmic	A, B	protein	106	Homo sapiens	Q9NP97 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2HZ5_1 Dynein light chain 2A, cytoplasmic (chains A, B)
MGHHHHHHGSMAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFI
LKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE

Ligands and cofactors

ID	Name	Formula	Copies
CS	Cesium ion	Cs	1

Primary citation

Crystal structure of human dynein light chain Dnlc2A: Structural insights into the interaction with IC74. Liu, J.-F., Wang, Z.-X., Wang, X.-Q. et al. Biochem Biophys Res Commun (2006) 349:1125-1129. DOI 10.1016/j.bbrc.2006.08.161 · PubMed

Other PDB entries of the same protein (UniProt Q9NP97 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6F1Z 3.4 Å, Roadblock-1 region of the dynein tail/dynactin/BICDR1 complex
6F1T 3.5 Å, Cryo-EM structure of two dynein tail domains bound to dynactin and BICDR1
9BLY 3.5 Å, Composite structure of full-length human dynein-1 in phi-particle conformation
6SC2 3.9 Å, Structure of the dynein-2 complex; IFT-train bound model
8RGH 3.9 Å, Structure of dynein-2 intermediate chain DYNC2I1 (WDR60) in complex with the dynein-2…
8RGG 4.0 Å, Structure of dynein-2 intermediate chain DYNC2I2 (WDR34) in complex with dynein-2 heavy…
8J07 4.1 Å, 96nm repeat of human respiratory doublet microtubule and associated axonemal complexes
9E28 4.4 Å, Cryo-EM structure of Phi dynein tail
6RLB 4.5 Å, Structure of the dynein-2 complex; tail domain
9E12 4.5 Å, Full-length human dynein-1 in phi comformation under Lis1 condition
9E13 4.5 Å, Full-length human dynein-1 in phi-like comformation bound to a Lis1 dimer under Lis1…
9E14 5.0 Å, Full-length human dynein-1 in phi-like comformation bound to a Lis1 dimer under…

Browse structure collections

About this viewer

MolViewer shows 2HZ5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.