2I04: MAGI-1 PDZ1

X-ray crystal structure of MAGI-1 PDZ1 bound to the C-terminal peptide of HPV18 E6. Determined by X-ray diffraction at 2.15 Å resolution. Released 20 Feb 2007.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Mus musculus
Chains: 4
Atoms: 1,608
Mol. weight: 20.24 kDa
Released: 20 Feb 2007

Explore 2I04 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2I04 contains 8 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	451-456	6	1
β-strand	458	1	2
β-strand	461	1	2
β-strand	464-468	5	1
β-strand	474	1	3
β-strand	476-481	6	1
α-helix	486-490	5
β-strand	498-502	5	1
β-strand	505-506	2	1
α-helix	512-520	9
α-helix	523	1
β-strand	527-533	7	1

Chain B: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	451-456	6	4
β-strand	458	1	5
β-strand	461	1	5
β-strand	464-468	5	4
β-strand	474	1	3
α-helix	475	1
β-strand	476-481	6	4
α-helix	486-490	5
α-helix	497	1
β-strand	498-502	5	4
β-strand	505-506	2	4
α-helix	512-520	9
α-helix	523	1
β-strand	527-533	7	4

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2004-2005	2	1

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2003-2005	3	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1	A, B	protein	85	Mus musculus	Q6RHR9 (AlphaFold model)
peptide E6	C, D	protein	7		P06463 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2I04_1 Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (chains A, B)
SIHTKLRKSSRGFGFTVVGGDEPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTCVLG
HTHAQVVKIFQSIPIGASVDLELCR

Sequence of entity 2 (C, D), FASTA

>2I04_2 peptide E6 (chains C, D)
RRRETQV

Primary citation

Structures of a Human Papillomavirus (HPV) E6 Polypeptide Bound to MAGUK Proteins: Mechanisms of Targeting Tumor Suppressors by a High-Risk HPV Oncoprotein. Zhang, Y., Dasgupta, J., Ma, R.Z. et al. J Virol (2007) 81:3618-3626. DOI 10.1128/JVI.02044-06 · PubMed

Other PDB entries of the same protein (UniProt Q6RHR9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5ZYS 1.78 Å, Structure of Nephrin/MAGI1 complex

Browse structure collections

About this viewer

MolViewer shows 2I04 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.