2I85: Human ephrinB2 ectodomain

NMR solution structure of Human ephrinB2 ectodomain. Determined by solution NMR. Released 4 Sept 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,136
Mol. weight: 16.2 kDa
Released: 4 Sept 2007

Explore 2I85 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2I85 contains 2 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	1
β-strand	23-26	4	2
β-strand	33-38	6	1
β-strand	52-54	3	3
β-strand	55-56	2	2
α-helix	59-64	6
β-strand	66	1	4
β-strand	75-77	3	3
β-strand	84-89	6	1
β-strand	106-111	6	2
α-helix	118-120	3
β-strand	125	1	4
β-strand	135-140	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ephrin-B2	A	protein	142	Homo sapiens	P52799 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2I85_1 Ephrin-B2 (chains A)
SKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKD
QADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEG
LDNQEGGVCQTRAMKILMKVGQ

Primary citation

NMR solution structure of Human ephrinB2 ectodomain. Ran, X., Fan, J., Song, J. To be published.

Other PDB entries of the same protein (UniProt P52799 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4UF7 1.7 Å, Ghanaian henipavirus (Gh-M74a) attachment glycoprotein in complex with human ephrinB2
2VSM 1.8 Å, Nipah virus attachment glycoprotein in complex with human cell surface receptor ephrinB2
2HLE 2.05 Å, Structural and biophysical characterization of the EPHB4-EPHRINB2 protein protein…
2WO2 2.45 Å, Crystal Structure of the EphA4-ephrinB2 complex
3GXU 2.5 Å, Crystal structure of Eph receptor and ephrin complex
6PDL 2.7 Å, Crystal Structure of Hendra Virus Attachment G Glycoprotein in Complex with Receptor…
6P7Y 2.84 Å, Crystal Structure of the Cedar henipavirus Attachment G Glycoprotein globular domain in…
9DVD 2.9 Å, Cryo EM structure of Hendra G ectodomain in complex with Ephrin-B2 and Fab HENV-270
2VSK 3.3 Å, Hendra virus attachment glycoprotein in complex with human cell surface receptor ephrinB2

Browse structure collections

About this viewer

MolViewer shows 2I85 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.