2IAL: CD4+ T cell receptor E8 alpha chain

Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR. Determined by X-ray diffraction at 1.92 Å resolution. Released 3 Apr 2007.

Method: X-ray diffraction
Resolution: 1.92 Å
Organism: Homo sapiens
Chains: 4
Atoms: 7,105
Mol. weight: 98.98 kDa
Released: 3 Apr 2007

Explore 2IAL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2IAL contains 23 α-helices and 88 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	1
β-strand	9-13	5	2
β-strand	18-24	7	1
β-strand	28-36	9	2
β-strand	42-47	6	2
β-strand	51-55	5	1
β-strand	58-63	6	1
β-strand	68-73	6	1
α-helix	78-80	3
β-strand	82-90	9	2
β-strand	95-98	4	2
β-strand	102-107	6	2
β-strand	116-121	6	3
β-strand	122	1	4
β-strand	129-134	6	3
α-helix	143-145	3
β-strand	151-152	2	3
α-helix	153-155	3
β-strand	156-160	5	3
α-helix	161-163	3
β-strand	165-173	9	3
α-helix	181-184	4
β-strand	195	1	3

Chain B: 6 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	5
β-strand	10-14	5	6
β-strand	19-21	3	7
β-strand	22-25	4	5
β-strand	31-37	7	6
β-strand	44-51	8	6
β-strand	54-57	4	6
β-strand	64-66	3	7
β-strand	73	1	5
β-strand	76-78	3	7
α-helix	83-85	3
β-strand	87-95	9	6
β-strand	98-101	4	6
β-strand	105-110	6	6
α-helix	113-115	3
β-strand	117	1	8
α-helix	118-119	2
β-strand	120-124	5	4
α-helix	125-127	3
α-helix	128-134	7
β-strand	136-146	11	4
β-strand	147	1	8
β-strand	151-157	7	9
β-strand	160-162	3	9
β-strand	166-168	3	4
β-strand	173-174	2	4
β-strand	184-193	10	4
α-helix	194-197	4
β-strand	203-210	8	9
β-strand	213	1	10
β-strand	227	1	10
β-strand	229-236	8	9

Chain C: 5 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	11
β-strand	9-13	5	12
β-strand	18-24	7	11
β-strand	28-36	9	12
β-strand	42-47	6	12
β-strand	51-55	5	11
β-strand	58-63	6	11
α-helix	64-66	3
β-strand	68-73	6	11
α-helix	78-80	3
β-strand	82-90	9	12
β-strand	95-98	4	12
β-strand	102-107	6	12
β-strand	116-119	4	13
β-strand	121-122	2	14
β-strand	129-134	6	13
α-helix	142-145	4
β-strand	150-152	3	13
α-helix	153-155	3
β-strand	156-160	5	13
β-strand	165-174	10	13
α-helix	181-184	4
β-strand	195	1	13

Chain D: 7 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	15
β-strand	10-14	5	16
β-strand	19-21	3	17
β-strand	22-25	4	15
β-strand	31-37	7	16
β-strand	43-51	9	16
β-strand	54-57	4	16
β-strand	65-66	2	17
β-strand	73	1	15
β-strand	76-78	3	17
α-helix	83-85	3
β-strand	87-95	9	16
β-strand	98-101	4	16
β-strand	105-110	6	16
α-helix	113-115	3
β-strand	117	1	18
α-helix	118-119	2
β-strand	120-125	6	14
α-helix	126-127	2
α-helix	128-134	7
β-strand	136-146	11	14
β-strand	147	1	18
β-strand	151-157	7	19
β-strand	160-162	3	19
β-strand	166-168	3	14
β-strand	173-174	2	14
β-strand	184-193	10	14
α-helix	194-197	4
β-strand	203-210	8	19
β-strand	213	1	20
α-helix	224-225	2
β-strand	227	1	20
β-strand	229-236	8	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CD4+ T cell receptor E8 alpha chain	A, C	protein	202	Homo sapiens	P01848 (AlphaFold model)
CD4+ T cell receptor E8 beta chain	B, D	protein	240	Homo sapiens	P01850 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>2IAL_1 CD4+ T cell receptor E8 alpha chain (chains A, C)
IQVEQSPPDLILQEGANSTLRCNFSDSVNNLQWFHQNPWGQLINLFYIPSGTKQNGRLSA
TTVATERYSLLYISSSQTTDSGVYFCAALIQGAQKLVFGQGTRLTINPNIQNPDPAVYQL
RDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFA
CANAFNNSIIPEDTFFPSPESS

Sequence of entity 2 (B, D), FASTA

>2IAL_2 CD4+ T cell receptor E8 beta chain (chains B, D)
NAGVTQTPKFRILKIGQSMTLQCTQDMNHNYMYWYRQDPGMGLKLIYYSVGAGITDKGEV
PNGYNVSRSTTEDFPLRLELAAPSQTSVYFCASTYHGTGYFGEGSWLTVVEDLNKVFPPE
VAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALN
DSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD

Primary citation

Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor. Deng, L., Langley, R.J., Brown, P.H. et al. Nat Immunol (2007) 8:398-408. DOI 10.1038/ni1447 · PubMed

Other PDB entries of the same protein (UniProt P01848 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4UDT 1.35 Å, T cell receptor (TRAV22,TRBV7-9) structure
4WW1 1.38 Å, Crystal structure of human TCR Alpha Chain-TRAV21-TRAJ8 and Beta Chain-TRBV7-8
1OGA 1.4 Å, A structural basis for immunodominant human T-cell receptor recognition.
2BNU 1.4 Å, Structural and kinetic basis for heightened immunogenicity of T cell vaccines
1KGC 1.5 Å, Immune Receptor
2BNQ 1.7 Å, Structural and kinetic basis for heightened immunogenicity of T cell vaccines
2BNR 1.9 Å, Structural and kinetic basis for heightened immunogenicity of T cell vaccines
5C0C 1.97 Å, 1E6 TCR in complex with HLA-A02 carrying RQFGPDWIVA
2VLM 1.98 Å, The Structural Dynamics and Energetics of an Immunodominant T-cell Receptor are…
5KSA 2.0 Å, Bel602-DQ8.5-glia-gamma1 complex
7RYL 2.0 Å, T cell receptor CO3
5EU6 2.02 Å, HLA Class I antigen

Browse structure collections

About this viewer

MolViewer shows 2IAL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.