2IGP: Hec1 CH domain

Crystal Structure of Hec1 CH domain. Determined by X-ray diffraction at 1.8 Å resolution. Released 2 Jan 2007.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,015
Mol. weight: 13.96 kDa
Released: 2 Jan 2007

Explore 2IGP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2IGP contains 5 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	89-105	17
α-helix	122-133	12
β-strand	144	1	1
β-strand	146	1	1
α-helix	147-157	11
α-helix	166-170	5
α-helix	178-194	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Retinoblastoma-associated protein HEC	A	protein	120	Homo sapiens	O14777 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2IGP_1 Retinoblastoma-associated protein HEC (chains A)
GSHMKDPRPLNDKAFIQQCIRQLCEFLTENGYAHNVSMKSLQAPSVKDFLKIFTFLYGFL
CPSYELPDTKFEEEVPRIFKDLGYPFALSKSSMYTVGAPHTWPHIVAALVWLIDCIKIHT

Primary citation

The Ndc80/HEC1 complex is a contact point for kinetochore-microtubule attachment. Wei, R.R., Al-Bassam, J., Harrison, S.C. Nat Struct Mol Biol (2007) 14:54-59. DOI 10.1038/nsmb1186 · PubMed

Other PDB entries of the same protein (UniProt O14777 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8G0P 2.0 Å, Crystal structure of the human Ndc80:Nuf2 loop region
2VE7 2.88 Å, Crystal structure of a bonsai version of the human Ndc80 complex
9N9G 3.0 Å, Cryo-EM structure of the human Hec1-Nuf2 dimer bound to the paclitaxel-stabilized…
3IZ0 8.6 Å, Human Ndc80 Bonsai Decorated Microtubule

Browse structure collections

About this viewer

MolViewer shows 2IGP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.