2IHS: B30.2/SPRY domain of GUSTAVUS

Crystal structure of the B30.2/SPRY domain of GUSTAVUS in complex with a 20-residue VASA peptide. Determined by X-ray diffraction at 2.2 Å resolution. Released 16 Jan 2007.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Drosophila melanogaster
Chains: 4
Atoms: 3,600
Mol. weight: 53.36 kDa
Released: 16 Jan 2007

Explore 2IHS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2IHS contains 11 α-helices and 40 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	39-46	8
α-helix	48-51	4
α-helix	52-57	6
β-strand	60-65	6	1
β-strand	69-71	3	2
β-strand	78-81	4	2
β-strand	84	1	3
β-strand	87-93	7	1
β-strand	97	1	4
β-strand	101-107	7	2
α-helix	110-112	3
β-strand	118-122	5	1
β-strand	129-131	3	1
β-strand	143-147	5	1
β-strand	152-155	4	1
β-strand	160	1	5
β-strand	163-164	2	1
α-helix	167-168	2
β-strand	180-186	7	2
β-strand	191-196	6	2
β-strand	199-206	8	2
β-strand	213	1	4
β-strand	214-219	6	1
β-strand	225-234	10	2

Chain B: 5 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	39-46	8
α-helix	48-50	3
α-helix	52-57	6
β-strand	60-65	6	6
β-strand	69-72	4	7
β-strand	75-81	7	7
β-strand	84	1	8
β-strand	87-93	7	6
β-strand	97	1	9
β-strand	101-107	7	7
α-helix	110-112	3
β-strand	118-122	5	6
β-strand	129-131	3	6
β-strand	143-147	5	6
β-strand	152-155	4	6
β-strand	160	1	5
β-strand	163-164	2	6
α-helix	167-168	2
β-strand	180-186	7	7
β-strand	191-195	5	7
β-strand	200-205	6	7
β-strand	213	1	9
β-strand	214-219	6	6
β-strand	225-233	9	7

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	189	1	3

Chain D: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	189	1	8
α-helix	195-199	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CG2944-PF, isoform F	A, B	protein	214	Drosophila melanogaster	A1Z6E0 (AlphaFold model)
20-mer from ATP-dependent RNA helicase vasa	C, D	protein	20	Drosophila melanogaster	P09052 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2IHS_1 CG2944-PF, isoform F (chains A, B)
GHMRELQADFVKPARIDILLDMPPASRDLQLKHSWNSEDRSLNIFVKEDDKLTFHRHPVA
QSTDCIRGKVGLTKGLHIWEIYWPTRQRGTHAVVGVCTADAPLHSVGYQSLVGSTEQSWG
WDLGRNKLYHDSKNCAGVTYPAILKNDEAFLVPDKFLVALDMDEGTLSFIVDQQYLGIAF
RGLRGKKLYPIVSAVWGHCEITMRYIGGLVDELN

Sequence of entity 2 (C, D), FASTA

>2IHS_2 20-mer from ATP-dependent RNA helicase vasa (chains C, D)
DINNNNNIVEDVERKREFYI

Primary citation

Structural Basis for Protein Recognition by B30.2/SPRY Domains. Woo, J.S., Suh, H.Y., Park, S.Y. et al. Mol Cell (2006) 24:967-976. DOI 10.1016/j.molcel.2006.11.009 · PubMed

Other PDB entries of the same protein (UniProt A1Z6E0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2FNJ 1.8 Å, Crystal structure of a B30.2/SPRY domain-containing protein GUSTAVUS in complex with…

Browse structure collections

About this viewer

MolViewer shows 2IHS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.