2IM0: Poliovirus polymerase

Crystal structure of poliovirus polymerase complexed with CTP and Mg2+. Determined by X-ray diffraction at 2.25 Å resolution. Released 12 Dec 2006.

Method: X-ray diffraction
Resolution: 2.25 Å
Organism: Human poliovirus 1
Chains: 1
Atoms: 3,957
Mol. weight: 53.91 kDa
Ligands: CTP
Released: 12 Dec 2006

Explore 2IM0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2IM0 contains 31 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
α-helix	15-18	4
β-strand	26-27	2	2
β-strand	39-40	2	3
α-helix	41-42	2
α-helix	54-59	6
α-helix	72-86	15
α-helix	94-96	3
α-helix	97-102	6
β-strand	104	1	4
β-strand	107	1	4
α-helix	108-110	3
α-helix	120-122	3
α-helix	127-130	4
α-helix	139-148	10
α-helix	152-153	2
β-strand	154-158	5	1
β-strand	162-163	2	3
α-helix	165-169	5
β-strand	175-178	4	1
α-helix	179-180	2
α-helix	181-200	20
β-strand	203	1	5
β-strand	208	1	5
α-helix	214-224	11
β-strand	228-230	3	5
β-strand	233-234	2	6
α-helix	237-240	4
α-helix	243-253	11
α-helix	254-258	5
α-helix	259-261	3
α-helix	263-269	7
β-strand	270-275	6	1
β-strand	278-283	6	1
β-strand	289	1	1
α-helix	293-312	20
α-helix	318-320	3
β-strand	322-326	5	5
β-strand	329-334	6	5
α-helix	340-349	10
β-strand	354-355	2	6
α-helix	357-359	3
β-strand	366	1	5
β-strand	373	1	7
β-strand	376	1	7
β-strand	377-380	4	8
β-strand	388-391	4	8
α-helix	394-401	8
β-strand	403-404	2	2
α-helix	407-409	3
α-helix	410-421	12
α-helix	422-424	3
α-helix	426-436	11
α-helix	440-443	4
α-helix	450-459	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
poliovirus polymerase	A	protein	461	Human poliovirus 1	P03300 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2IM0_1 poliovirus polymerase (chains A)
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFS
KYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPY
VAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASS
LNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDAS
LSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMI
NNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKS
ATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLL
AWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF

Ligands and cofactors

ID	Name	Formula	Copies
CTP	Cytidine-5'-triphosphate	C9 H16 N3 O14 P3	1

Water and common crystallization additives (ACY, NA) are not listed.

Primary citation

Stabilization of Poliovirus Polymerase by NTP Binding and Fingers-Thumb Interactions. Thompson, A.A., Albertini, R.A., Peersen, O.B. J Mol Biol (2007) 366:1459-1474. DOI 10.1016/j.jmb.2006.11.070 · PubMed

Other PDB entries of the same protein (UniProt P03300 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DCD 1.69 Å, 1.6A resolution structure of PolioVirus 3C Protease Containing a covalently bound…
9U04 1.7 Å, LX-2D6 (Fab) - Polio 1 (VLP) complex
1RA6 2.0 Å, Poliovirus Polymerase Full Length Apo Structure
4NLR 2.0 Å, Poliovirus Polymerase - C290S Loop Mutant
4NLS 2.0 Å, Poliovirus Polymerase - S288A Loop Mutant
1L1N 2.1 Å, Poliovirus 3C proteinase
4NLU 2.1 Å, Poliovirus Polymerase - G289A Loop Mutant
4NLW 2.1 Å, Poliovirus Polymerase - G289A/C290I Loop Mutant
1HXS 2.2 Å, Crystal structure of mahoney strain of poliovirus at 2.2A resolution
4NLO 2.2 Å, Poliovirus Polymerase - C290I Loop Mutant
4NLP 2.2 Å, Poliovirus Polymerase - C290V Loop Mutant
1TQL 2.3 Å, Poliovirus polymerase G1A mutant

Browse structure collections

About this viewer

MolViewer shows 2IM0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.