2J0U: EIF4AIII-Barentsz complex

The crystal structure of eIF4AIII-Barentsz complex at 3.0 A resolution. Determined by X-ray diffraction at 3.0 Å resolution. Released 6 Sept 2006.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: HOMO SAPIENS
Chains: 3
Atoms: 5,139
Mol. weight: 98.91 kDa
Released: 6 Sept 2006

Explore 2J0U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2J0U contains 33 α-helices and 27 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	41-43	3
α-helix	47-55	9
α-helix	63-74	12
β-strand	78-81	4	1
α-helix	90-99	10
β-strand	109-112	4	1
α-helix	116-130	15
β-strand	139-140	2	1
α-helix	146-154	9
β-strand	159-162	4	1
α-helix	164-172	9
β-strand	183-186	4	1
α-helix	189-193	5
α-helix	198-206	9
β-strand	213-218	6	1
α-helix	223-232	10
β-strand	237-239	3	1
β-strand	252-257	6	2
α-helix	264-271	8
β-strand	280-283	4	2
α-helix	287-299	13
β-strand	304-307	4	2
α-helix	313-325	13
β-strand	330-333	4	2
β-strand	348-351	4	2
α-helix	358-364	7
β-strand	376-381	6	2
α-helix	383-385	3
α-helix	386-396	11
β-strand	401-402	2	2

Chain B: 17 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	41-43	3
α-helix	47-55	9
α-helix	63-73	11
β-strand	78-80	3	3
α-helix	90-99	10
β-strand	109-112	4	3
α-helix	116-130	15
β-strand	137-139	3	3
α-helix	150-154	5
β-strand	159-162	4	3
α-helix	164-172	9
β-strand	183-186	4	3
α-helix	189-192	4
α-helix	198-206	9
β-strand	213-217	5	3
α-helix	223-232	10
β-strand	237-239	3	3
β-strand	251-257	7	4
α-helix	264-270	7
α-helix	272-278	7
β-strand	280-283	4	4
α-helix	287-297	11
α-helix	316-325	10
β-strand	330-331	2	4
β-strand	348-351	4	4
α-helix	361-364	4
β-strand	375-381	7	4
α-helix	383-385	3
α-helix	386-396	11
β-strand	401-402	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ATP-dependent RNA helicase DDX48	A	protein	374	HOMO SAPIENS	P38919 (AlphaFold model)
ATP-dependent RNA helicase DDX48	B	protein	374	HOMO SAPIENS	P38919 (AlphaFold model)
Protein CASC3	T	protein	114	HOMO SAPIENS	O15234 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2J0U_1 ATP-DEPENDENT RNA HELICASE DDX48 (chains A)
PTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSVSVL
QCLDIQVRETQALILAPTRELAVQVQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQ
HVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLI
SATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTI
TQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVW
ARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAVNFVKNDDIRVLRDIEQYYS
TQIDEMPMNVADLI

Sequence of entity 2 (B), FASTA

>2J0U_2 ATP-DEPENDENT RNA HELICASE DDX48 (chains B)
PTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSVSVL
QCLDIQVRETQALILAPTRELAVQVQKGLLALGDYMNVQSHACIGGTNVGEDIRKLDYGQ
HVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLI
SATLPHEVLEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTI
TQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVW
ARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAVNFVKNDDIRVLRDIEQYYS
TQIDEMPMNVADLI

Sequence of entity 3 (T), FASTA

>2J0U_3 PROTEIN CASC3 (chains T)
DTKSTVTGERQSGDGQESTEPVENKVGKKGPKHLDDDEDRKNPAYIPRKGLFFEHDLRGQ
TQEEEVRPKGRQRKLWKDEGRWEHDKFREDEQAPKSRQELIALYGYDIRSAHNP

Primary citation

The Crystal Structure of the Exon Junction Complex Reveals How It Mantains a Stable Grip on Mrna. Bono, F., Ebert, J., Lorentzen, E. et al. Cell (2006) 126:713. DOI 10.1016/J.CELL.2006.08.006 · PubMed

Other PDB entries of the same protein (UniProt P38919 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4C9B 2.0 Å, Crystal structure of eIF4AIII-CWC22 complex
2J0S 2.21 Å, The crystal structure of the Exon Junction Complex at 2.2 A resolution
2HYI 2.3 Å, Structure of the human exon junction complex with a trapped DEAD-box helicase bound to RNA
3EX7 2.3 Å, The crystal structure of EJC in its transition state
7ZNJ 2.4 Å, Structure of an ALYREF-exon junction complex hexamer
8C6J 2.8 Å, Human spliceosomal PM5 C* complex
9XTT 2.92 Å, Human minor spliceosome branching-completed C complex (after step-I)
6ICZ 3.0 Å, Cryo-EM structure of a human post-catalytic spliceosome (P complex) at 3.0 angstrom
9XU3 3.0 Å, Human minor spliceosome exon-ligation-ready C* complex (prior to step-II)
6YVH 3.19 Å, CWC22-CWC27-EIF4A3 Complex
2J0Q 3.2 Å, The crystal structure of the Exon Junction Complex at 3.2 A resolution
2HXY 3.3 Å, Crystal structure of human apo-eIF4AIII

Browse structure collections

About this viewer

MolViewer shows 2J0U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.