Crystal Structure of Human Rho-related GTP-binding protein RhoD. Determined by X-ray diffraction at 2.5 Å resolution. Released 18 Sept 2006.
Explore 2J1L in 3D Show helices and sheets RCSB PDB PDBe
2J1L contains 9 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17-24 | 8 | 1 |
| α-helix | 30-38 | 9 | |
| β-strand | 52-60 | 9 | 1 |
| β-strand | 63-71 | 9 | 1 |
| β-strand | 89-97 | 9 | 1 |
| α-helix | 101-106 | 6 | |
| α-helix | 107-111 | 5 | |
| α-helix | 112-118 | 7 | |
| β-strand | 124-129 | 6 | 1 |
| α-helix | 131-134 | 4 | |
| α-helix | 137-145 | 9 | |
| α-helix | 150-152 | 3 | |
| α-helix | 153-162 | 10 | |
| β-strand | 167-170 | 4 | 1 |
| β-strand | 172 | 1 | 2 |
| β-strand | 177 | 1 | 2 |
| α-helix | 179-192 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Rho-related GTP-binding protein rhod | A | protein | 214 | HOMO SAPIENS | O00212 (AlphaFold model) |
>2J1L_1 RHO-RELATED GTP-BINDING PROTEIN RHOD (chains A) MHHHHHHSSGVDLGTENLYFQSMAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFP ESYTPTVFERYMVNLQVKGKPVHLHIWDTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNS FDNIFNRWYPEVNHFCKKVPIIVVGCKTDLRKDKSLVNKLRRNGLEPVTYHRGQEMARSV GAVAYLECSARLHDNVHAVFQEAAEVALSSRGRN
Crystal Structure of Human Rho-Related GTP-Binding Protein Rhod. Pike, A.C.W., Johansson, C., Gileadi, C. et al. To be published.
Other PDB entries of the same protein (UniProt O00212 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2J1L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.