2J1N: Osmoporin OmpC

osmoporin OmpC. Determined by X-ray diffraction at 2.0 Å resolution. Released 6 Sept 2006.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: ESCHERICHIA COLI
Chains: 3
Atoms: 8,802
Mol. weight: 117.03 kDa
Ligands: D12, MG
Released: 6 Sept 2006

Explore 2J1N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2J1N contains 22 α-helices and 77 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
β-strand	9-23	15	1
β-strand	31-32	2	1
β-strand	35-45	11	1
β-strand	50-61	12	1
β-strand	71-82	12	1
β-strand	86-94	9	1
α-helix	98-101	4
α-helix	102-104	3
β-strand	124-134	11	1
α-helix	135-138	4
β-strand	143-150	8	1
β-strand	153	1	2
β-strand	155	1	3
α-helix	156	1
β-strand	165	1	3
α-helix	172-174	3
β-strand	176	1	2
β-strand	179-188	10	1
β-strand	191-201	11	1
α-helix	202-203	2
β-strand	212	1	4
β-strand	217-229	13	1
β-strand	232-242	11	1
β-strand	246	1	5
β-strand	251	1	4
β-strand	252	1	5
β-strand	255-265	11	1
β-strand	271-283	13	1
β-strand	292-305	14	1
β-strand	310-319	10	1
α-helix	325-330	6
β-strand	337-345	9	1

Chain B: 6 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	6
β-strand	9-23	15	6
β-strand	31-32	2	6
β-strand	35-45	11	6
β-strand	50-61	12	6
β-strand	71-82	12	6
β-strand	86-94	9	6
α-helix	98-101	4
α-helix	102-104	3
β-strand	124-133	10	6
β-strand	143-150	8	6
β-strand	153	1	7
β-strand	155	1	8
α-helix	156	1
β-strand	165	1	8
α-helix	172-174	3
β-strand	176	1	7
β-strand	179-188	10	6
β-strand	191-201	11	6
α-helix	202-203	2
β-strand	212	1	9
β-strand	217-229	13	6
β-strand	232-242	11	6
β-strand	246	1	10
β-strand	251	1	9
β-strand	252	1	10
β-strand	255-265	11	6
β-strand	271-283	13	6
β-strand	292-307	16	6
β-strand	310-319	10	6
α-helix	325-330	6
β-strand	337-345	9	6

Chain C: 9 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	11
β-strand	9-23	15	11
β-strand	31-32	2	11
β-strand	35-45	11	11
β-strand	50-61	12	11
β-strand	71-82	12	11
β-strand	86-94	9	11
α-helix	98-101	4
α-helix	102-104	3
β-strand	124-133	10	11
α-helix	135-138	4
β-strand	143-150	8	11
β-strand	153	1	12
β-strand	155	1	13
α-helix	156	1
β-strand	165	1	13
α-helix	172-174	3
β-strand	176	1	12
β-strand	179-188	10	11
β-strand	191-201	11	11
α-helix	202-203	2
α-helix	204-206	3
β-strand	212	1	14
β-strand	217-229	13	11
β-strand	232-242	11	11
β-strand	246-247	2	14
β-strand	251-252	2	14
β-strand	255-265	11	11
β-strand	271-283	13	11
β-strand	292-307	16	11
β-strand	310-319	10	11
α-helix	321-323	3
α-helix	325-330	6
β-strand	337-345	9	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer membrane protein C	A, B, C	protein	346	ESCHERICHIA COLI	P06996 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>2J1N_1 OUTER MEMBRANE PROTEIN C (chains A, B, C)
AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQI
QGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNF
MQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGV
GGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQ
TYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDV
GATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Ligands and cofactors

ID	Name	Formula	Copies
D12	Dodecane	C12 H26	11
MG	Magnesium ion	Mg	3

Water and common crystallization additives (CL) are not listed.

Primary citation

Crystal Structure of Osmoporin Ompc from E. Coli at 2.0 A. Basle, A., Rummel, G., Storici, P. et al. J Mol Biol (2006) 362:933. DOI 10.1016/J.JMB.2006.08.002 · PubMed

Other PDB entries of the same protein (UniProt P06996 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8I8R 2.93 Å, Cryo-EM Structure of OmpC3-MlaA Complex in MSP2N2 Nanodiscs
2J4U 2.99 Å, E.coli OmpC - camel Lactoferrin complex
8I8X 3.25 Å, Cryo-EM Structure of OmpC3-MlaA-MlaC Complex in MSP2N2 Nanodiscs
3NB3 19.0 Å, The host outer membrane proteins OmpA and OmpC are packed at specific sites in the…
2ZLE 28.0 Å, Cryo-EM structure of DegP12/OMP
4A8D 28.0 Å, DegP dodecamer with bound OMP
9A32 Model of E. coli OmpC by in-cell photo-crosslinking MS and deep learning

Browse structure collections

About this viewer

MolViewer shows 2J1N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.