2J49: Yeast TAF5 N-terminal domain

Crystal structure of yeast TAF5 N-terminal domain. Determined by X-ray diffraction at 2.3 Å resolution. Released 10 Apr 2007.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 1
Atoms: 1,153
Mol. weight: 17.28 kDa
Released: 10 Apr 2007

Explore 2J49 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2J49 contains 11 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	152-164	13
α-helix	171-192	22
α-helix	194-204	11
α-helix	205-208	4
α-helix	209-217	9
α-helix	225-230	6
α-helix	232-238	7
α-helix	241	1
β-strand	242-246	5	1
α-helix	248-260	13
α-helix	262-264	3
α-helix	266-276	11
β-strand	277-281	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription initiation factor tfiid subunit 5	A	protein	148	SACCHAROMYCES CEREVISIAE	P38129 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2J49_1 TRANSCRIPTION INITIATION FACTOR TFIID SUBUNIT 5 (chains A)
GSHMNAPENYIRAYSMLKNWVDSSLEIYKPELSYIMYPIFIYLFLNLVAKNPVYARRFFD
RFSPDFKDFHGSEINRLFSVNSIDHIKENEVASAFQSHKYRITMSKTTLNLLLYFLNENE
SIGGSLIISVINQHLDPNIVESVTAREK

Primary citation

Crystal Structure, Biochemical and Genetic Characterization of Yeast and E. Cuniculi Taf(II)5 N-Terminal Domain: Implications for TFIID Assembly. Romier, C., James, N., Birck, C. et al. J Mol Biol (2007) 368:1292. DOI 10.1016/J.JMB.2007.02.039 · PubMed

Other PDB entries of the same protein (UniProt P38129 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6T9K 3.3 Å, SAGA Core module
6T9I 3.9 Å, cryo-EM structure of transcription coactivator SAGA

Browse structure collections

About this viewer

MolViewer shows 2J49 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.