2J4U: E.coli OmpC - camel Lactoferrin complex

E.coli OmpC - camel Lactoferrin complex. Determined by X-ray diffraction at 2.99 Å resolution. Released 13 Feb 2007.

Method: X-ray diffraction
Resolution: 2.99 Å
Organisms: ESCHERICHIA COLI, CAMELUS DROMEDARIUS
Chains: 8
Atoms: 16,534
Mol. weight: 240.42 kDa
Released: 13 Feb 2007

Explore 2J4U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2J4U contains 34 α-helices and 144 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain P: 4 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	1002-1005	4	1
β-strand	1010-1023	14	1
β-strand	1031-1032	2	1
β-strand	1035-1045	11	1
β-strand	1051-1061	11	1
β-strand	1073-1081	9	1
β-strand	1087-1093	7	1
α-helix	1097-1101	5
α-helix	1102-1104	3
β-strand	1125-1133	9	1
α-helix	1136-1138	3
β-strand	1143-1150	8	1
β-strand	1155	1	2
β-strand	1161	1	2
β-strand	1182-1186	5	1
β-strand	1192-1201	10	1
β-strand	1212	1	3
β-strand	1217-1229	13	1
β-strand	1232-1242	11	1
β-strand	1251	1	3
β-strand	1255-1265	11	1
β-strand	1271-1283	13	1
β-strand	1292-1307	16	1
β-strand	1310-1318	9	1
α-helix	1325-1330	6
β-strand	1337-1345	9	1

Chain Q: 6 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	1005	1	4
β-strand	1010-1024	15	4
β-strand	1031-1032	2	4
β-strand	1035-1045	11	4
β-strand	1051-1061	11	4
β-strand	1073-1081	9	4
β-strand	1087-1093	7	4
α-helix	1097-1101	5
α-helix	1102-1104	3
β-strand	1119	1	5
β-strand	1121	1	5
β-strand	1125-1133	9	4
α-helix	1136-1138	3
β-strand	1143-1150	8	4
β-strand	1155	1	6
β-strand	1161	1	6
β-strand	1182-1186	5	4
β-strand	1192-1201	10	4
α-helix	1202-1203	2
α-helix	1204-1206	3
β-strand	1212	1	7
β-strand	1217-1229	13	4
β-strand	1232-1242	11	4
β-strand	1251	1	7
β-strand	1255-1265	11	4
β-strand	1271-1283	13	4
β-strand	1292-1307	16	4
β-strand	1310-1319	10	4
α-helix	1325-1330	6
β-strand	1337-1345	9	4

Chain R: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	1002-1005	4	8
β-strand	1010-1023	14	8
β-strand	1031-1032	2	8
β-strand	1035-1045	11	8
β-strand	1051-1061	11	8
β-strand	1073-1081	9	8
β-strand	1087-1093	7	8
α-helix	1097-1101	5
α-helix	1102-1104	3
β-strand	1125-1133	9	8
α-helix	1136-1138	3
β-strand	1143-1150	8	8
β-strand	1155	1	9
β-strand	1161	1	9
β-strand	1182-1186	5	8
β-strand	1192-1201	10	8
α-helix	1202-1203	2
α-helix	1204-1206	3
β-strand	1212	1	10
β-strand	1217-1229	13	8
β-strand	1232-1242	11	8
β-strand	1251	1	10
β-strand	1255-1265	11	8
β-strand	1271-1283	13	8
β-strand	1292-1307	16	8
β-strand	1310-1318	9	8
α-helix	1321-1323	3
α-helix	1326-1330	5
β-strand	1337-1345	9	8

Chain S: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	1006	1	11
α-helix	1014-1016	3
β-strand	1024	1	12
β-strand	1027	1	12
β-strand	1034	1	11

Chain U: 5 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	1005	1	13
β-strand	1010-1023	14	13
β-strand	1031-1032	2	13
β-strand	1035-1045	11	13
β-strand	1051-1061	11	13
β-strand	1073-1081	9	13
β-strand	1087-1093	7	13
α-helix	1097-1101	5
α-helix	1102-1104	3
β-strand	1119	1	14
β-strand	1121	1	14
β-strand	1125-1133	9	13
α-helix	1136-1138	3
β-strand	1143-1150	8	13
β-strand	1155	1	15
β-strand	1161	1	15
β-strand	1182-1186	5	13
β-strand	1192-1201	10	13
α-helix	1204-1206	3
β-strand	1212	1	16
β-strand	1217-1229	13	13
β-strand	1232-1242	11	13
β-strand	1251	1	16
β-strand	1255-1265	11	13
β-strand	1271-1283	13	13
β-strand	1292-1307	16	13
β-strand	1310-1318	9	13
α-helix	1325-1330	6
β-strand	1337-1345	9	13

Chain V: 5 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	1005	1	17
β-strand	1010-1023	14	17
β-strand	1031-1032	2	17
β-strand	1035-1045	11	17
β-strand	1051-1061	11	17
β-strand	1073-1081	9	17
β-strand	1087-1092	6	17
β-strand	1093	1	18
α-helix	1098-1101	4
α-helix	1102-1104	3
β-strand	1125	1	18
β-strand	1128-1133	6	17
α-helix	1136-1138	3
β-strand	1143-1150	8	17
β-strand	1155	1	19
β-strand	1161	1	19
β-strand	1182-1186	5	17
β-strand	1192-1201	10	17
α-helix	1204-1206	3
β-strand	1212	1	20
β-strand	1217-1229	13	17
β-strand	1232-1242	11	17
β-strand	1251	1	20
β-strand	1255-1265	11	17
β-strand	1271-1283	13	17
β-strand	1292-1308	17	17
β-strand	1310-1319	10	17
α-helix	1325-1330	6
β-strand	1337-1345	9	17

Chain W: 5 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	1005	1	21
β-strand	1010-1023	14	21
β-strand	1031-1032	2	21
β-strand	1035-1045	11	21
β-strand	1051-1061	11	21
β-strand	1073-1081	9	21
β-strand	1087-1092	6	21
β-strand	1093	1	22
α-helix	1097-1101	5
α-helix	1102-1104	3
β-strand	1125	1	22
β-strand	1128-1133	6	21
α-helix	1136-1138	3
β-strand	1143-1150	8	21
β-strand	1155	1	23
β-strand	1161	1	23
β-strand	1182-1186	5	21
β-strand	1192-1201	10	21
β-strand	1212	1	24
β-strand	1217-1229	13	21
β-strand	1232-1242	11	21
β-strand	1251	1	24
β-strand	1255-1265	11	21
β-strand	1271-1283	13	21
β-strand	1292-1307	16	21
β-strand	1310-1319	10	21
α-helix	1321-1323	3
α-helix	1326-1330	5
β-strand	1337-1345	9	21

Chain X: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1017-1020	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer membrane protein C precursor	P, Q, R, U, V, W	protein	346	ESCHERICHIA COLI	P06996 (AlphaFold model)
Lactotransferrin	S, X	protein	45	CAMELUS DROMEDARIUS	Q9TUM0 (AlphaFold model)

Sequence of entity 1 (P, Q, R, U, V, W), FASTA

>2J4U_1 OUTER MEMBRANE PROTEIN C PRECURSOR (chains P, Q, R, U, V, W)
AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQI
QGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNF
MQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGV
GGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQ
TYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDV
GATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Sequence of entity 2 (S, X), FASTA

>2J4U_2 LACTOTRANSFERRIN (chains S, X)
ASKKSVRWCTTSPAESKKCAQWQRRMKKVRGPSVTCVKKTSRFEC

Primary citation

Crystal Structure of the Membrane Protein Ompc Complex with Antibacterial Lactoferrin. Baalaji, S., Acharya, R.K., Singh, T.P. et al. To be published.

Other PDB entries of the same protein (UniProt P06996 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2J1N 2.0 Å, osmoporin OmpC
8I8R 2.93 Å, Cryo-EM Structure of OmpC3-MlaA Complex in MSP2N2 Nanodiscs
8I8X 3.25 Å, Cryo-EM Structure of OmpC3-MlaA-MlaC Complex in MSP2N2 Nanodiscs
3NB3 19.0 Å, The host outer membrane proteins OmpA and OmpC are packed at specific sites in the…
2ZLE 28.0 Å, Cryo-EM structure of DegP12/OMP
4A8D 28.0 Å, DegP dodecamer with bound OMP
9A32 Model of E. coli OmpC by in-cell photo-crosslinking MS and deep learning

Browse structure collections

About this viewer

MolViewer shows 2J4U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.