2J5X: Small G protein ARF6

Structure of the small G protein ARF6 in complex with gtpgammas. Determined by X-ray diffraction at 2.8 Å resolution. Released 21 Sept 2006.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 2,733
Mol. weight: 41.35 kDa
Ligands: MG, GSP
Released: 21 Sept 2006

Explore 2J5X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2J5X contains 16 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	12-19	8	1
α-helix	26-35	10
β-strand	47-53	7	1
β-strand	57-64	8	1
α-helix	68-73	6
α-helix	75-78	4
β-strand	83-89	7	1
α-helix	93-95	3
α-helix	96-108	13
α-helix	110-112	3
β-strand	116-122	7	1
α-helix	132-138	7
β-strand	149-153	5	1
β-strand	155	1	2
β-strand	160	1	2
α-helix	162-171	10

Chain B: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	13-19	7	3
α-helix	26-35	10
β-strand	47-54	8	3
β-strand	57-64	8	3
α-helix	68-77	10
β-strand	83-89	7	3
α-helix	93-95	3
α-helix	96-107	12
α-helix	110-112	3
β-strand	116-122	7	3
α-helix	132-138	7
α-helix	141-143	3
β-strand	149-153	5	3
β-strand	155	1	4
β-strand	160	1	4
α-helix	162-170	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ADP-ribosylation factor 6	A, B	protein	175	HOMO SAPIENS	P62330 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2J5X_1 ADP-RIBOSYLATION FACTOR 6 (chains A, B)
MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN
VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF
ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
GSP	5'-guanosine-diphosphate-monothiophosphate	C10 H16 N5 O13 P3 S	2

Primary citation

The Structural Gdp-GTP Cycle of Human Arf6. Pasqualato, S., Menetrey, J., Franco, M. et al. EMBO Rep (2001) 2:234. DOI 10.1093/EMBO-REPORTS/KVE043 · PubMed

Other PDB entries of the same protein (UniProt P62330 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2A5D 1.8 Å, Structural basis for the activation of cholera toxin by human ARF6-GTP
3N5C 1.82 Å, Crystal Structure of Arf6DELTA13 complexed with GDP
4KAX 1.85 Å, Crystal structure of the Grp1 PH domain in complex with Arf6-GTP
2W83 1.93 Å, Crystal structure of the ARF6 GTPase in complex with a specific effector, JIP4
6PAU 1.93 Å, Structure of Human NMT2 with myristoyl-lysine peptide and CoA products
2A5F 2.02 Å, Cholera toxin A1 subunit bound to its substrate, NAD+, and its human protein activator,…
7RK3 2.05 Å, Crystal structure of human N-myristoyltransferase 1 fragment (residues 109-496) bound to…
1E0S 2.28 Å, small G protein Arf6-GDP
3PCR 2.5 Å, Structure of EspG-Arf6 complex
6PAV 2.52 Å, Structure of Human NMT1 with products CoA and myristoyl-lysine peptide with acetylated…
2A5G 2.66 Å, Cholera toxin A1 subunit bound to ARF6(Q67L)
3LVQ 3.38 Å, The crystal structure of ASAP3 in complex with Arf6 in transition state

Browse structure collections

About this viewer

MolViewer shows 2J5X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.