Epstein-Barr virus uracil-DNA glycosylase in complex with Ugi from PBS-2. Determined by X-ray diffraction at 2.3 Å resolution. Released 13 Dec 2006.
Explore 2J8X in 3D Show helices and sheets RCSB PDB PDBe
2J8X contains 30 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 32-38 | 7 | |
| α-helix | 42-59 | 18 | |
| β-strand | 64-65 | 2 | 1 |
| α-helix | 73-75 | 3 | |
| α-helix | 80-82 | 3 | |
| β-strand | 85-89 | 5 | 2 |
| α-helix | 110-112 | 3 | |
| α-helix | 113-125 | 13 | |
| α-helix | 138-141 | 4 | |
| β-strand | 145-149 | 5 | 2 |
| β-strand | 154-155 | 2 | 1 |
| β-strand | 158 | 1 | 1 |
| α-helix | 167-181 | 15 | |
| β-strand | 186-190 | 5 | 2 |
| α-helix | 192-195 | 4 | |
| α-helix | 196-200 | 5 | |
| β-strand | 207-211 | 5 | 2 |
| α-helix | 216-220 | 5 | |
| α-helix | 235-245 | 11 | |
| α-helix | 249-251 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-12 | 9 | |
| β-strand | 20-24 | 5 | 3 |
| α-helix | 26-33 | 8 | |
| β-strand | 41-48 | 8 | 3 |
| β-strand | 53-60 | 8 | 3 |
| β-strand | 67-73 | 7 | 3 |
| β-strand | 79-83 | 5 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 32-38 | 7 | |
| α-helix | 42-58 | 17 | |
| β-strand | 64-65 | 2 | 4 |
| α-helix | 73-75 | 3 | |
| α-helix | 80-82 | 3 | |
| β-strand | 85-89 | 5 | 5 |
| α-helix | 110-112 | 3 | |
| α-helix | 113-125 | 13 | |
| α-helix | 138-142 | 5 | |
| β-strand | 145-149 | 5 | 5 |
| β-strand | 154-155 | 2 | 4 |
| β-strand | 158 | 1 | 4 |
| α-helix | 167-181 | 15 | |
| β-strand | 186-190 | 5 | 5 |
| α-helix | 192-195 | 4 | |
| α-helix | 196-200 | 5 | |
| β-strand | 207-211 | 5 | 5 |
| α-helix | 216-220 | 5 | |
| α-helix | 235-245 | 11 | |
| α-helix | 249-251 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-12 | 8 | |
| β-strand | 20-24 | 5 | 6 |
| α-helix | 26-33 | 8 | |
| β-strand | 41-48 | 8 | 6 |
| β-strand | 53-60 | 8 | 6 |
| β-strand | 67-73 | 7 | 6 |
| β-strand | 79-83 | 5 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Uracil-DNA glycosylase | A, C | protein | 231 | EPSTEIN-BARR VIRUS | P12888 (AlphaFold model) |
| Uracil-DNA glycosylase inhibitor | B, D | protein | 84 | BACILLUS PHAGE PBS2 | P14739 (AlphaFold model) |
>2J8X_1 URACIL-DNA GLYCOSYLASE (chains A, C) GENLLLPDLWLDFLQLSPIFQRKLAAVIACVRRLRTQATVYPEEDMCMAWARFCDPSDIK VVILGQDPYHGGQANGLAFSVAYGFPVPPSLRNIYAELHRSLPEFSPPDHGCLDAWASQG VLLLNTILTVQKGKPGSHADIGWAWFTDHVISLLSERLKACVFMLWGAKAGDKASLINSK KHLVLTSQHPSPLAQNSTRKSAQQKFLGNNHFVLANNFLREKGLGEIDWRL
>2J8X_2 URACIL-DNA GLYCOSYLASE INHIBITOR (chains B, D) MTNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTS DAPEYKPWALVIQDSNGENKIKML
| ID | Name | Formula | Copies |
|---|---|---|---|
| URE | Urea | C H4 N2 O | 2 |
New Insights on the Role of the Gamma-Herpesvirus Uracil-DNA Glycosylase Leucine Loop Revealed by the Structure of the Epstein-Barr Virus Enzyme in Complex with an Inhibitor Protein. Geoui, T., Buisson, M., Tarbouriech, N. et al. J Mol Biol (2007) 366:117. DOI 10.1016/J.JMB.2006.11.007 · PubMed
Other PDB entries of the same protein (UniProt P12888 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2J8X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.