C-terminal domain of influenza A virus polymerase PB2 subunit in complex with human importin alpha5. Determined by X-ray diffraction at 2.2 Å resolution. Released 27 Feb 2007.
Explore 2JDQ in 3D Show helices and sheets RCSB PDB PDBe
2JDQ contains 76 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 85-92 | 8 | |
| α-helix | 96-111 | 16 | |
| α-helix | 118-122 | 5 | |
| α-helix | 127-135 | 9 | |
| α-helix | 141-155 | 15 | |
| α-helix | 159-167 | 9 | |
| α-helix | 170-177 | 8 | |
| α-helix | 183-197 | 15 | |
| α-helix | 201-209 | 9 | |
| α-helix | 213-219 | 7 | |
| α-helix | 226-240 | 15 | |
| α-helix | 246-248 | 3 | |
| α-helix | 249-251 | 3 | |
| α-helix | 253-255 | 3 | |
| α-helix | 256-262 | 7 | |
| α-helix | 268-281 | 14 | |
| α-helix | 286-294 | 9 | |
| α-helix | 298-304 | 7 | |
| α-helix | 310-323 | 14 | |
| α-helix | 328-335 | 8 | |
| α-helix | 339-346 | 8 | |
| α-helix | 352-365 | 14 | |
| α-helix | 370-378 | 9 | |
| α-helix | 381-391 | 11 | |
| α-helix | 394-410 | 17 | |
| α-helix | 413-422 | 10 | |
| α-helix | 425-430 | 6 | |
| α-helix | 431-433 | 3 | |
| α-helix | 437-460 | 24 | |
| α-helix | 467-476 | 10 | |
| α-helix | 478-485 | 8 | |
| α-helix | 487-504 | 18 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 85-91 | 7 | |
| α-helix | 96-109 | 14 | |
| α-helix | 118-122 | 5 | |
| α-helix | 128-134 | 7 | |
| α-helix | 141-155 | 15 | |
| α-helix | 159-167 | 9 | |
| α-helix | 170-177 | 8 | |
| α-helix | 183-197 | 15 | |
| α-helix | 201-209 | 9 | |
| α-helix | 213-218 | 6 | |
| α-helix | 226-240 | 15 | |
| α-helix | 246-248 | 3 | |
| α-helix | 249-252 | 4 | |
| α-helix | 253-255 | 3 | |
| α-helix | 256-262 | 7 | |
| α-helix | 268-281 | 14 | |
| α-helix | 286-294 | 9 | |
| α-helix | 298-303 | 6 | |
| α-helix | 304-306 | 3 | |
| α-helix | 310-323 | 14 | |
| α-helix | 328-335 | 8 | |
| α-helix | 339-346 | 8 | |
| α-helix | 352-365 | 14 | |
| α-helix | 370-378 | 9 | |
| α-helix | 382-391 | 10 | |
| α-helix | 394-410 | 17 | |
| α-helix | 413-421 | 9 | |
| α-helix | 425-431 | 7 | |
| α-helix | 437-460 | 24 | |
| α-helix | 467-476 | 10 | |
| α-helix | 478-485 | 8 | |
| α-helix | 487-503 | 17 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 691-693 | 3 | |
| β-strand | 694-699 | 6 | 1 |
| α-helix | 702-704 | 3 | |
| α-helix | 707 | 1 | |
| β-strand | 708 | 1 | 1 |
| α-helix | 709 | 1 | |
| α-helix | 712-715 | 4 | |
| α-helix | 717 | 1 | |
| β-strand | 721-727 | 7 | 1 |
| β-strand | 730-736 | 7 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 687-691 | 5 | |
| β-strand | 694-699 | 6 | 2 |
| α-helix | 702-704 | 3 | |
| α-helix | 707 | 1 | |
| β-strand | 708 | 1 | 2 |
| α-helix | 709 | 1 | |
| α-helix | 713-715 | 3 | |
| α-helix | 717 | 1 | |
| β-strand | 722-727 | 6 | 2 |
| β-strand | 730-736 | 7 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Importin alpha-1 subunit | A, B | protein | 450 | HOMO SAPIENS | P52294 (AlphaFold model) |
| Polymerase basic protein 2 | D, E | protein | 83 | INFLUENZA A VIRUS | P31345 |
>2JDQ_1 IMPORTIN ALPHA-1 SUBUNIT (chains A, B) GAMGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVI STPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEF EDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRG KSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLV ELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTI SNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVEL GCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIE FLQSHENQEIYQKAFDLIEHYFGTEDEDSS
>2JDQ_2 POLYMERASE BASIC PROTEIN 2 (chains D, E) GDPDESTSGVESAVLRGFLILGKEDRRYGPALSINELSNLAKGEKANVLIGQGDVVLVMK RKRDSSILTDSQTATKRIRMAIN
Structure and Nuclear Import Function of the C- Terminal Domain of Influenza Virus Polymerase Pb2 Subunit. Tarendeau, F., Boudet, J., Guilligay, D. et al. Nat Struct Mol Biol (2007) 14:229. DOI 10.1038/NSMB1212 · PubMed
Other PDB entries of the same protein (UniProt P52294 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2JDQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.