6WX9: SOX2

SOX2 bound to Importin-alpha 5. Determined by X-ray diffraction at 2.8 Å resolution. Released 28 Oct 2020.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,462
Mol. weight: 62.77 kDa
Released: 28 Oct 2020

Explore 6WX9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6WX9 contains 34 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 34 helices, 0 β-strands

Element	Residues	Length
α-helix	85-92	8
α-helix	96-110	15
α-helix	118-122	5
α-helix	128-134	7
α-helix	141-154	14
α-helix	159-167	9
α-helix	170-178	9
α-helix	183-197	15
α-helix	201-209	9
α-helix	213-217	5
α-helix	218-221	4
α-helix	226-240	15
α-helix	246-248	3
α-helix	249-252	4
α-helix	253-255	3
α-helix	256-262	7
α-helix	268-281	14
α-helix	286-294	9
α-helix	298-305	8
α-helix	310-323	14
α-helix	328-336	9
α-helix	340-346	7
α-helix	352-366	15
α-helix	370-378	9
α-helix	382-391	10
α-helix	394-409	16
α-helix	415-422	8
α-helix	425-430	6
α-helix	431-433	3
α-helix	437-460	24
α-helix	468-474	7
α-helix	477-483	7
α-helix	484-486	3
α-helix	490-503	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Importin subunit alpha-5	A	protein	467	Homo sapiens	P52294 (AlphaFold model)
Transcription factor SOX-2	B	protein	90	Homo sapiens	P48431 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6WX9_1 Importin subunit alpha-5 (chains A)
SSNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARF
VEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVW
ALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAK
VSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYK
VVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRA
QIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDL
LTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQE
IYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL

Sequence of entity 2 (B), FASTA

>6WX9_2 Transcription factor SOX-2 (chains B)
SDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRL
RALHMKEHPDYKYRPRRKTKTLMKKDKYTL

Primary citation

Structural basis for nuclear import selectivity of pioneer transcription factor SOX2. Jagga, B., Edwards, M., Pagin, M. et al. Nat Commun (2021) 12:28-28. DOI 10.1038/s41467-020-20194-0 · PubMed

Other PDB entries of the same protein (UniProt P52294 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2JDQ 2.2 Å, C-terminal domain of influenza A virus polymerase PB2 subunit in complex with human…
4B18 2.52 Å, The crystal structure of human Importin alpha 5 with TERT NLS peptide
3TJ3 2.7 Å, Structure of importin a5 bound to the N-terminus of Nup50

Browse structure collections

About this viewer

MolViewer shows 6WX9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.