2JEL: JEL42 fab/hpr complex

JEL42 fab/hpr complex. Determined by X-ray diffraction at 2.5 Å resolution. Released 27 May 1998.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: Mus musculus, Escherichia coli
Chains: 3
Atoms: 4,014
Mol. weight: 56.28 kDa
Released: 27 May 1998

Explore 2JEL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JEL contains 16 α-helices and 50 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	7
β-strand	10-12	3	2
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	33-39	7	2
β-strand	45-51	7	2
β-strand	57-59	3	2
α-helix	61-63	3
β-strand	64	1	7
β-strand	67-72	6	7
α-helix	73-75	3
β-strand	77-82	6	7
α-helix	84-86	3
β-strand	88-96	9	2
β-strand	99-103	6	2
β-strand	107-111	5	2
β-strand	117	1	8
β-strand	120-124	5	9
β-strand	137-147	11	9
β-strand	148	1	8
β-strand	153-157	4	10
β-strand	166	1	10
β-strand	171-173	3	9
α-helix	174-176	3
β-strand	177-179	3	9
β-strand	184-194	11	9
β-strand	207-212	6	10
α-helix	213-215	3
β-strand	217-222	6	10

Chain L: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	4-7	4	1
β-strand	10-14	5	2
β-strand	19-25	7	1
β-strand	27C	1	3
β-strand	31	1	3
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-107	6	2
β-strand	111	1	4
β-strand	114-118	5	5
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	5
β-strand	140	1	4
β-strand	144-151	8	6
β-strand	154-155	2	6
β-strand	159-163	5	5
β-strand	173-182	10	5
α-helix	183-187	5
β-strand	191-198	8	6
β-strand	201-210	10	6

Chain P: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	11
α-helix	16-26	11
β-strand	32-37	6	11
β-strand	40-43	4	11
α-helix	47-51	5
β-strand	60-66	7	11
α-helix	70-82	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
JEL42 FAB fragment	L	protein	217	Mus musculus
JEL42 FAB fragment	H	protein	218	Mus musculus
Histidine-containing protein	P	protein	85	Escherichia coli	P0AA04 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>2JEL_1 JEL42 FAB FRAGMENT (chains L)
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHGNGNTYLEWYLQKPGQSPKLLIYKISNRF
SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLEIKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIGDGARQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSDSPIVKSFNRN

Sequence of entity 2 (H), FASTA

>2JEL_2 JEL42 FAB FRAGMENT (chains H)
QVQLAQSGPELVRPGVSVKISCKGSGYTFTTYAMHWVKQSHAKSLEWIGLISTYSGYTNY
NQKFKGKATMTVDKSSSTAYMELARLTSEDSAIYYCARVMGEQYFDVWGAGTTVIVSSAA
TTPPSVYPLAPGSGGQGNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLAADLY
TLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIAPG

Sequence of entity 3 (P), FASTA

>2JEL_3 HISTIDINE-CONTAINING PROTEIN (chains P)
MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTV
VTISAEGEDEQKAVEHLVKLMAELE

Primary citation

The 2.5 A resolution structure of the jel42 Fab fragment/HPr complex. Prasad, L., Waygood, E.B., Lee, J.S. et al. J Mol Biol (1998) 280:829-845. DOI 10.1006/jmbi.1998.1888 · PubMed

Other PDB entries of the same protein (UniProt P0AA04 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CCD 1.0 Å, 1.0 A Structure of Post-Succinimide His15Asp HPr
1OPD 1.5 Å, Histidine-containing protein (HPR), mutant with ser 46 replaced by asp (S46D)
1CM3 1.6 Å, HIS15ASP hpr from E. Coli
1CM2 1.8 Å, Structure of HIS15ASP hpr after hydrolysis of ringed species.
1POH 2.0 Å, The 2.0 Å resolution structure of escherichia coli histidine-containing phosphocarrier…
9S8K 2.06 Å, Structure of glycogen phosphorylase - tetrameric form - in complex with HPr from…
4XWJ 2.1 Å, Histidine-containing phosphocarrier protein (HPr) and antisigma factor Rsd complex
5YA1 2.7 Å, crystal structure of LsrK-HPr complex with ATP
5YA2 2.7 Å, Crystal structure of LsrK-HPr complex with ADP
9S8B 2.79 Å, Structure of glycogen phosphorylase - dimeric form - in complex with HPr from…
5YA0 3.0 Å, Crystal structure of LsrK and HPr complex
6KCR 3.5 Å, X-ray structure of the MtlR-HPr complex from Escherichia coli

Browse structure collections

About this viewer

MolViewer shows 2JEL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.