2JMD: Ring Domain of Human TRAF6

Solution Structure of the Ring Domain of Human TRAF6. Determined by solution NMR. Released 10 Apr 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 489
Mol. weight: 7.15 kDa
Ligands: ZN
Released: 10 Apr 2007

Explore 2JMD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JMD contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8-9	2	1
β-strand	14-15	2	1
β-strand	20-21	2	2
α-helix	22	1
β-strand	27-28	2	2
α-helix	34-37	4
β-strand	43	1	3
β-strand	50	1	3
α-helix	53-55	3
β-strand	57-58	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TNF receptor-associated factor 6	A	protein	63	Homo sapiens	Q9Y4K3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JMD_1 TNF receptor-associated factor 6 (chains A)
GPLGSKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDN
FAK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structure, interactions, and dynamics of the RING domain from human TRAF6. Mercier, P., Lewis, M.J., Hau, D.D. et al. Protein Sci (2007) 16:602-614. DOI 10.1110/ps.062358007 · PubMed

Other PDB entries of the same protein (UniProt Q9Y4K3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LB6 1.8 Å, TRAF6-CD40 Complex
3HCT 2.1 Å, Crystal structure of TRAF6 in complex with Ubc13 in the P1 space group
6A33 2.1 Å, Binding and Enhanced Binding between Key Immunity Proteins TRAF6 and TIFA
3HCS 2.2 Å, Crystal structure of the N-terminal domain of TRAF6
1LB4 2.4 Å, TRAF6 apo structure
1LB5 2.4 Å, TRAF6-RANK Complex
3HCU 2.6 Å, Crystal structure of TRAF6 in complex with Ubc13 in the C2 space group
5ZUJ 2.6 Å, Binding and Enhanced Binding between Key Immunity Proteins TRAF6 and TIFA
8HZ2 2.6 Å, Tumor Necrosis Factor Receptor Associated Factor 6 (TRAF6) N-terminal Domain
7L3L 2.8 Å, Structure of TRAF5 and TRAF6 RING Hetero dimer
4Z8M 2.95 Å, Crystal structure of the MAVS-TRAF6 complex
2ECI Solution structure of the RING domain of the human TNF receptor-associated factor 6…

Browse structure collections

About this viewer

MolViewer shows 2JMD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.