3HCS: N-terminal domain of TRAF6

Crystal structure of the N-terminal domain of TRAF6. Determined by X-ray diffraction at 2.2 Å resolution. Released 26 May 2009.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,724
Mol. weight: 40.28 kDa
Ligands: ZN
Released: 26 May 2009

Explore 3HCS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3HCS contains 22 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	56	1	1
β-strand	59-60	2	2
α-helix	63-65	3
α-helix	66-68	3
β-strand	69	1	1
β-strand	76	1	1
β-strand	80-82	3	3
β-strand	88-90	3	3
α-helix	91-101	11
β-strand	104	1	4
β-strand	111	1	4
α-helix	114-116	3
β-strand	118-119	2	3
α-helix	121-128	8
β-strand	131-133	3	2
β-strand	142-144	3	2
α-helix	145-147	3
α-helix	148-152	5
β-strand	159-161	3	5
β-strand	168-170	3	5
α-helix	171-173	3
α-helix	174-176	3
α-helix	177-181	5
β-strand	186-188	3	6
β-strand	195-197	3	6
α-helix	198-200	3
α-helix	201-205	5

Chain B: 10 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	56	1	7
β-strand	60	1	8
α-helix	63-65	3
α-helix	66-68	3
β-strand	69	1	7
β-strand	76	1	7
β-strand	80-82	3	9
β-strand	88-90	3	9
α-helix	91-101	11
β-strand	104	1	10
β-strand	111	1	10
α-helix	114-116	3
β-strand	118-119	2	9
α-helix	121-128	8
β-strand	131-133	3	8
β-strand	142-144	3	8
α-helix	145-152	8
β-strand	159-161	3	11
β-strand	168-170	3	11
α-helix	174-176	3
α-helix	177-181	5
β-strand	186-188	3	12
β-strand	195-197	3	12
α-helix	198-200	3
α-helix	201-205	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TNF receptor-associated factor 6	A, B	protein	170	Homo sapiens	Q9Y4K3 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3HCS_1 TNF receptor-associated factor 6 (chains A, B)
MEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDN
EILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPF
QKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLALEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	10

Primary citation

E2 interaction and dimerization in the crystal structure of TRAF6. Yin, Q., Lin, S.C., Lamothe, B. et al. Nat Struct Mol Biol (2009) 16:658-666. DOI 10.1038/nsmb.1605 · PubMed

Other PDB entries of the same protein (UniProt Q9Y4K3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LB6 1.8 Å, TRAF6-CD40 Complex
3HCT 2.1 Å, Crystal structure of TRAF6 in complex with Ubc13 in the P1 space group
6A33 2.1 Å, Binding and Enhanced Binding between Key Immunity Proteins TRAF6 and TIFA
1LB4 2.4 Å, TRAF6 apo structure
1LB5 2.4 Å, TRAF6-RANK Complex
3HCU 2.6 Å, Crystal structure of TRAF6 in complex with Ubc13 in the C2 space group
5ZUJ 2.6 Å, Binding and Enhanced Binding between Key Immunity Proteins TRAF6 and TIFA
8HZ2 2.6 Å, Tumor Necrosis Factor Receptor Associated Factor 6 (TRAF6) N-terminal Domain
7L3L 2.8 Å, Structure of TRAF5 and TRAF6 RING Hetero dimer
4Z8M 2.95 Å, Crystal structure of the MAVS-TRAF6 complex
2ECI Solution structure of the RING domain of the human TNF receptor-associated factor 6…
2JMD Solution Structure of the Ring Domain of Human TRAF6

Browse structure collections

About this viewer

MolViewer shows 3HCS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.