Solution structure of the CUL7-CPH domain from Homo Sapiens; Northeast Structural Genomics Consortium target HT1. Determined by solution NMR. Released 27 Feb 2007.
Explore 2JNG in 3D Show helices and sheets RCSB PDB PDBe
2JNG contains 3 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-7 | 3 | |
| α-helix | 12-21 | 10 | |
| β-strand | 27-30 | 4 | 1 |
| β-strand | 34 | 1 | 2 |
| β-strand | 37 | 1 | 2 |
| β-strand | 42-48 | 7 | 1 |
| β-strand | 50 | 1 | 3 |
| β-strand | 52 | 1 | 3 |
| β-strand | 54-59 | 6 | 1 |
| β-strand | 64-69 | 6 | 1 |
| α-helix | 70-72 | 3 | |
| β-strand | 73-75 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cullin-7 | A | protein | 105 | Homo sapiens | Q14999 (AlphaFold model) |
>2JNG_1 Cullin-7 (chains A) GSHMRSEFASGNTYALYVRDTLQPGMRVRMLDDYEEISAGDEGEFRQSNNGVPPVQVFWE STGRTYWVHWHMLEILGFEEDIEDMVEADEYQGAVASRVLGRALP
The Conserved CPH Domains of Cul7 and PARC Are Protein-Protein Interaction Modules That Bind the Tetramerization Domain of p53. Kaustov, L., Lukin, J., Lemak, A. et al. J Biol Chem (2007) 282:11300-11307. DOI 10.1074/jbc.M611297200 · PubMed
Other PDB entries of the same protein (UniProt Q14999 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2JNG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.