2JNS: Bromodomain-containing protein 4 ET domain

Solution structure of the Bromodomain-containing protein 4 ET domain. Determined by solution NMR. Released 5 Feb 2008.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 720
Mol. weight: 10.32 kDa
Released: 5 Feb 2008

Explore 2JNS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JNS contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	20-30	11
α-helix	35-38	4
α-helix	41-46	6
α-helix	50-52	3
α-helix	69-80	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bromodomain-containing protein 4	A	protein	90	Mus musculus	Q9ESU6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JNS_1 Bromodomain-containing protein 4 (chains A)
GSSGSSGESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEI
EIDFETLKPSTLRELERYVTSCLRKKRKPQ

Primary citation

Solution structure of the Bromodomain-containing protein 4 ET domain. Lin, Y.J., Padmanabhan, B., Yokoyama, S. et al. To be published.

Other PDB entries of the same protein (UniProt Q9ESU6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3JVL 1.2 Å, Crystal structure of bromodomain 2 of mouse Brd4
3JVM 1.2 Å, Crystal structure of bromodomain 2 of mouse Brd4
3JVJ 1.55 Å, Crystal structure of the bromodomain 1 in mouse Brd4
3MUL 1.65 Å, Crystal structure of Brd4 bromodomain 1 with butyrylated histone H3-K(buty)14
3MUK 1.75 Å, Crystal structure of Brd4 bromodomain 1 with propionylated histone H3-K(prop)23
2DWW 1.8 Å, Crystal structure of Bromodomain-containing protein 4
3JVK 1.8 Å, Crystal structure of bromodomain 1 of mouse Brd4 in complex with histone H3-K(ac)14

Browse structure collections

About this viewer

MolViewer shows 2JNS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.