3MUL: Bromodomain-containing protein 4

Crystal structure of Brd4 bromodomain 1 with butyrylated histone H3-K(buty)14. Determined by X-ray diffraction at 1.65 Å resolution. Released 11 Aug 2010.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Mus musculus
Chains: 2
Atoms: 1,202
Mol. weight: 16.36 kDa
Released: 11 Aug 2010

Explore 3MUL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3MUL contains 9 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	44-49	6
α-helix	61-65	5
α-helix	66-71	6
α-helix	72-74	3
α-helix	81-83	3
α-helix	97-100	4
α-helix	107-115	9
α-helix	122-139	18
α-helix	145-161	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bromodomain-containing protein 4	A	protein	131	Mus musculus	Q9ESU6 (AlphaFold model)
Peptide of Histone H3.3	D	protein	8		P84243 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3MUL_1 Bromodomain-containing protein 4 (chains A)
GAMGSTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDY
YKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLF
LQKINELPTEE

Sequence of entity 2 (D), FASTA

>3MUL_2 Peptide of Histone H3.3 (chains D)
GGXAPRKQ

Primary citation

Interaction of propionylated and butyrylated histone H3 lysine marks with Brd4 bromodomains. Vollmuth, F., Geyer, M. Angew Chem Int Ed Engl (2010) 49:6768-6772. DOI 10.1002/anie.201002724 · PubMed

Other PDB entries of the same protein (UniProt Q9ESU6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3JVL 1.2 Å, Crystal structure of bromodomain 2 of mouse Brd4
3JVM 1.2 Å, Crystal structure of bromodomain 2 of mouse Brd4
3JVJ 1.55 Å, Crystal structure of the bromodomain 1 in mouse Brd4
3MUK 1.75 Å, Crystal structure of Brd4 bromodomain 1 with propionylated histone H3-K(prop)23
2DWW 1.8 Å, Crystal structure of Bromodomain-containing protein 4
3JVK 1.8 Å, Crystal structure of bromodomain 1 of mouse Brd4 in complex with histone H3-K(ac)14
2JNS Solution structure of the Bromodomain-containing protein 4 ET domain

Browse structure collections

About this viewer

MolViewer shows 3MUL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.