2JRS: RNA-binding protein 39

Solution NMR Structure of CAPER RRM2 Domain. Northeast Structural Genomics Target HR4730A. Determined by solution NMR. Released 4 Sept 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 842
Mol. weight: 12.06 kDa
Released: 4 Sept 2007

Explore 2JRS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JRS contains 2 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	27-32	6	1
α-helix	40-47	8
β-strand	53-61	9	1
β-strand	66-75	10	1
α-helix	78-88	11
β-strand	99-101	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA-binding protein 39	A	protein	108	Homo sapiens	Q14498 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JRS_1 RNA-binding protein 39 (chains A)
MGHHHHHHSHMAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMM
DSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKVGHVTERTD

Primary citation

Solution NMR Structure of CAPER RRM2 Domain. Rossi, P., Xiao, R., Acton, T.B. et al. To be published.

Other PDB entries of the same protein (UniProt Q14498 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4YUD 1.28 Å, Crystal structure of a RNA binding motif protein 39 (RBM39) from Homo sapiens at 1.28 A…
4OZ1 1.74 Å, Crystal structure of human CAPERalpha UHM bound to SF3b155 ULM5
4OZ0 2.2 Å, Crystal structure of human CAPERalpha U2AF homology motif (apo-state)
6UD7 2.3 Å, Crystal structure of full-length human DCAF15-DDB1(deltaBPB)-DDA1-RBM39 in complex with…
6UE5 2.61 Å, Crystal structure of full-length human DCAF15-DDB1-deltaPBP-DDA1-RBM39 in complex with…
4OO6 2.7 Å, Crystal structure of human KAP-beta2 bound to the NLS of HCC1 (Hepato Cellular Carcinoma…
6PAI 2.9 Å, Structure of the human DDB1-DDA1-DCAF15 E3 ubiquitin ligase bound to RBM39 and…
6Q0R 2.9 Å, Structure of DDB1-DDA1-DCAF15 complex bound to E7820 and RBM39
6Q0V 2.9 Å, Structure of DDB1-DDA1-DCAF15 complex bound to tasisulam and RBM39
6Q0W 2.9 Å, Structure of DDB1-DDA1-DCAF15 complex bound to Indisulam and RBM39
6SJ7 3.54 Å, Structure of the human DDB1-DDA1-DCAF15 E3 ubiquitin ligase bound to RBM39 and Indisulam
2MHN NMR structure of the first RRM domain of the protein RBM39 from Homo sapiens

Browse structure collections

About this viewer

MolViewer shows 2JRS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.