Crystal structure of a RNA binding motif protein 39 (RBM39) from Homo sapiens at 1.28 A resolution. Determined by X-ray diffraction at 1.28 Å resolution. Released 1 Apr 2015.
Explore 4YUD in 3D Show helices and sheets RCSB PDB PDBe
4YUD contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 144-146 | 3 | |
| α-helix | 147-151 | 5 | |
| β-strand | 154-160 | 7 | 1 |
| α-helix | 166-173 | 8 | |
| β-strand | 179-184 | 6 | 1 |
| β-strand | 195-201 | 7 | 1 |
| α-helix | 206-211 | 6 | |
| β-strand | 217-218 | 2 | 2 |
| β-strand | 221-222 | 2 | 2 |
| β-strand | 224-227 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| RNA-binding protein 39 | A | protein | 92 | Homo sapiens | Q14498 (AlphaFold model) |
>4YUD_1 RNA-binding protein 39 (chains A) GNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFV DVSSVPLAIGLTGQRVLGVPIIVQASQAEKNR
Crystal structure of a RNA binding motif protein 39 (RBM39) from Homo sapiens at 1.28 A resolution. Joint Center for Structural Genomics (JCSG), Partnership for T-Cell Biology (TCELL). To be published.
Other PDB entries of the same protein (UniProt Q14498 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4YUD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.