NMR structure of iota-RXIA(38). Determined by solution NMR. Released 19 Aug 2008.
Explore 2JTU in 3D Show helices and sheets RCSB PDB PDBe
2JTU contains 0 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 21-23 | 3 | 1 |
| β-strand | 26-28 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| I-superfamily conotoxin r11a | A | protein | 38 | Q7Z094 (AlphaFold model) |
>2JTU_1 I-superfamily conotoxin r11a (chains A) GPSFCKADEKPCEYHADCCNCCLSGICAPSTNWILPGC
NMR structure of iota-RXIA(38). Wei, D., Norton, R. To be published.
Other PDB entries of the same protein (UniProt Q7Z094 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2JTU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.