Mutations in the hydrophobic core of ubiquitin differentially affect its recognition by receptor proteins. Determined by solution NMR. Released 8 Jan 2008.
Explore 2JWZ in 3D Show helices and sheets RCSB PDB PDBe
2JWZ contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-6 | 4 | 1 |
| β-strand | 12-15 | 4 | 1 |
| β-strand | 22 | 1 | 2 |
| α-helix | 23-34 | 12 | |
| α-helix | 38-40 | 3 | |
| β-strand | 42-45 | 4 | 1 |
| β-strand | 48-49 | 2 | 1 |
| α-helix | 50-51 | 2 | |
| β-strand | 55 | 1 | 2 |
| β-strand | 65-70 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin | A | protein | 76 | Saccharomyces cerevisiae | P0CG63 (AlphaFold model) |
>2JWZ_1 Ubiquitin (chains A) MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHSVLRLRGG
Mutations in the hydrophobic core of ubiquitin differentially affect its recognition by receptor proteins. Haririnia, A., Verma, R., Purohit, N. et al. J Mol Biol (2008) 375:979-996. DOI 10.1016/j.jmb.2007.11.016 · PubMed
Other PDB entries of the same protein (UniProt P0CG63 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2JWZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.