NMR structure of human Serine protease inhibitor Kazal type II (SPINK2). Determined by solution NMR. Released 18 Nov 2008.
Explore 2JXD in 3D Show helices and sheets RCSB PDB PDBe
2JXD contains 2 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10 | 1 | 1 |
| β-strand | 29-31 | 3 | 1 |
| β-strand | 36-37 | 2 | 1 |
| α-helix | 43-45 | 3 | |
| α-helix | 46-50 | 5 | |
| β-strand | 56-58 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine protease inhibitor Kazal-type 2 | A | protein | 62 | Homo sapiens | P20155 (AlphaFold model) |
>2JXD_1 Serine protease inhibitor Kazal-type 2 (chains A) PQFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNG PC
Identification of trypsin-inhibitory site and structure determination of human SPINK2 serine proteinase inhibitor. Chen, T., Lee, T.-R., Liang, W.-G. et al. Proteins (2009) 77:209-219. DOI 10.1002/prot.22432 · PubMed
Other PDB entries of the same protein (UniProt P20155 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2JXD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.