6KBR: Kallikrein-4

Crystal structure of Human KLK4 and SPINK2 derived KLK4 inhibitor complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 17 Jul 2019.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,193
Mol. weight: 34.4 kDa
Released: 17 Jul 2019

Explore 6KBR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KBR contains 13 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	32	1	1
β-strand	35-36	2	2
α-helix	37-38	2
β-strand	45-50	6	3
β-strand	53-62	10	3
β-strand	65-68	4	3
α-helix	70-72	3
β-strand	77-81	5	3
β-strand	85	1	4
β-strand	95-99	5	3
β-strand	101-104	4	3
β-strand	118-121	4	3
α-helix	125-128	4
α-helix	136	1
β-strand	137	1	2
α-helix	138	1
α-helix	141-142	2
β-strand	147-152	6	2
α-helix	160-162	3
β-strand	164	1	4
β-strand	166-172	7	2
α-helix	173-174	2
α-helix	175-182	8
β-strand	190-194	5	2
β-strand	201	1	1
β-strand	210-213	4	2
β-strand	216-224	9	2
β-strand	234-239	6	2
α-helix	240-242	3
α-helix	244-252	9

Chain C: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	15-17	3
β-strand	23-24	2	2
β-strand	30-32	3	5
β-strand	37-38	2	5
α-helix	41-51	11
β-strand	57-60	4	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kallikrein-4	A	protein	254	Homo sapiens	Q9Y5K2 (AlphaFold model)
K41043	C	protein	65	Homo sapiens	P20155 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6KBR_1 Kallikrein-4 (chains A)
MATAGNPWGWFLGYLILGVAGSLVSGSCSQIINGEDCSPHSQPWQAALVMENELFCSGVL
VHPQWVLSAAHCFQNSYTIGLGLHSLEADQEPGSQMVEASLSVRHPEYNRPLLANDLMLI
KLDESVSESDTIRSISIASQCPTAGNSCLVSGWGLLANGRMPTVLQCVNVSVVSEEVCSK
LYDPLYHPSMFCAGGGHDQKDSCNGDSGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNL
CKFTEWIEKTVQAS

Sequence of entity 2 (C), FASTA

>6KBR_2 K41043 (chains C)
PQFGLFSKYRTPNCRRYSIHGCNRMYAPVCGSDMSTYANECTLCMKIREGGHNIKIIKNG
PCGAS

Primary citation

A protein scaffold, engineered SPINK2, for generation of inhibitors with high affinity and specificity against target proteases. Nishimiya, D., Kawaguchi, Y., Kodama, S. et al. Sci Rep (2019) 9:11436-11436. DOI 10.1038/s41598-019-47615-5 · PubMed

Other PDB entries of the same protein (UniProt Q9Y5K2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4K8Y 1.0 Å, Atomic resolution crystal structures of Kallikrein-Related Peptidase 4 complexed with…
4KEL 1.15 Å, Atomic resolution crystal structure of Kallikrein-Related Peptidase 4 complexed with a…
6O21 1.15 Å, Crystal Structure of Human KLK4 in Complex With Cleaved SFTI-FCQR(Asn14)[1,14] Inhibitor
4K1E 1.3 Å, Atomic resolution crystal structures of Kallikrein-Related Peptidase 4 complexed with a…
7JOD 1.33 Å, Crystal structure of BbKI complexed with Human Kallikrein 4
7JQK 1.33 Å, Crystal structure of the R64A mutant of Bauhinia Bauhinioides Kallikrein Inhibitor…
7JQN 1.5 Å, Crystal structure of the R64M mutant of Bauhinia Bauhinioides Kallikrein Inhibitor…
7JQO 1.6 Å, Crystal structure of the R64D mutant of Bauhinia Bauhinioides Kallikrein Inhibitor…
6NVB 1.64 Å, Crystal structure of the inhibitor-free form of the serine protease kallikrein-4
7JOW 1.91 Å, Crystal structure of BbKI complexed with Human Kallikrein 4
2BDG 1.95 Å, Human Kallikrein 4 complex with nickel and p-aminobenzamidine
7JOS 2.1 Å, Crystal structure of BbKI complexed with Human Kallikrein 4

Browse structure collections

About this viewer

MolViewer shows 6KBR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.