Solution Conformation of A Non-Amyloidogenic Analogue of Human Calcitonin in Sodium Dodecyl Sulfate Micelles. Determined by solution NMR. Released 25 Nov 2008.
Explore 2JXZ in 3D Show helices and sheets RCSB PDB PDBe
2JXZ contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-21 | 18 | |
| α-helix | 25-27 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Calcitonin | A | protein | 33 | P01258 (AlphaFold model) |
>2JXZ_1 Calcitonin (chains A) CGNLSTCMLGTLTQDFHKFHTFPQTNTGVGTPX
Converting the highly amyloidogenic human calcitonin into a powerful fibril inhibitor by 3D structure homology with a non-amyloidogenic analogue. Andreotti, G., Vitale, R.M., Avidan-Shpalter, C. et al. J Biol Chem (2011) 286:2707-2718. DOI 10.1074/jbc.M110.182014 · PubMed
Other PDB entries of the same protein (UniProt P01258 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2JXZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.