Human Granulin A. Determined by solution NMR. Released 22 Apr 2008.
Explore 2JYE in 3D Show helices and sheets RCSB PDB PDBe
2JYE contains 0 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 18-20 | 3 | 1 |
| β-strand | 26-28 | 3 | 1 |
| β-strand | 50-51 | 2 | 2 |
| β-strand | 56-57 | 2 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Granulin A | A | protein | 72 | Homo sapiens | P28799 (AlphaFold model) |
>2JYE_1 Granulin A (chains A) AMDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQK LAAALEHHHHHH
Structure dissection of human progranulin identifies well-folded granulin/epithelin modules with unique functional activities. Tolkatchev, D., Malik, S., Vinogradova, A. et al. Protein Sci (2008) 17:711-724. DOI 10.1110/ps.073295308 · PubMed
Other PDB entries of the same protein (UniProt P28799 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2JYE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.