2JYW: C-terminal domain of APOBEC3G

Solution structure of C-terminal domain of APOBEC3G. Determined by solution NMR. Released 26 Feb 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,545
Mol. weight: 22.78 kDa
Ligands: ZN
Released: 26 Feb 2008

Explore 2JYW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JYW contains 6 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	1
β-strand	24-31	8	2
β-strand	34-36	3	2
β-strand	46	1	1
α-helix	62-72	11
β-strand	79-85	7	2
α-helix	92-103	12
β-strand	108-114	7	2
α-helix	125-134	10
β-strand	137-140	4	2
α-helix	143-153	11
α-helix	161-164	4
α-helix	166-183	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA dC->dU-editing enzyme APOBEC-3G	A	protein	195	Homo sapiens	Q9HC16 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JYW_1 DNA dC->dU-editing enzyme APOBEC-3G (chains A)
GPLGSPEFDPPTFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVKLNQRRGFLANQAPHK
HGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCI
KTARIYDDQGRAQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGAPFQPWDGLDEHSQ
DLSGRLRAILQNQEN

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Structure of the DNA deaminase domain of the HIV-1 restriction factor APOBEC3G. Chen, K.M., Harjes, E., Gross, P.J. et al. Nature (2008) 452:116-119. DOI 10.1038/nature06638 · PubMed

Other PDB entries of the same protein (UniProt Q9HC16 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3V4K 1.38 Å, First-In-Class Small Molecule Inhibitors of the Single-strand DNA Cytosine Deaminase…
7UXD 1.5 Å, Crystal structure of APOBEC3G Catalytic domain complex with ssDNA containing 2'-deoxy…
4ROW 1.7 Å, The crystal structure of novel APOBEC3G CD2 head-to-tail dimer suggests the binding mode…
4ROV 1.8 Å, The crystal structure of novel APOBEC3G CD2 head-to-tail dimer suggests the binding mode…
6BUX 1.86 Å, Crystal structure of APOBEC3G catalytic domain complex with substrate ssDNA
5ZVB 2.0 Å, APOBEC3F Chimeric Catalytic Domain in Complex with DNA(dT9)
3V4J 2.04 Å, First-In-Class Small Molecule Inhibitors of the Single-strand DNA Cytosine Deaminase…
3IR2 2.25 Å, Crystal structure of the APOBEC3G catalytic domain
3E1U 2.3 Å, The Crystal Structure of the Anti-Viral APOBEC3G Catalytic Domain
3IQS 2.3 Å, Crystal structure of the anti-viral APOBEC3G catalytic domain
5ZVA 2.3 Å, APOBEC3F Chimeric Catalytic Domain in Complex with DNA(dC9)
8J62 2.5 Å, Cryo-EM structure of APOBEC3G-Vif complex

Browse structure collections

About this viewer

MolViewer shows 2JYW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.