APOBEC3F Chimeric Catalytic Domain in Complex with DNA(dC9). Determined by X-ray diffraction at 2.3 Å resolution. Released 21 Nov 2018.
Explore 5ZVA in 3D Show helices and sheets RCSB PDB PDBe
5ZVA contains 25 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | -28--27 | 2 | 1 |
| α-helix | -24 | 1 | |
| β-strand | -23 | 1 | 2 |
| α-helix | -22 | 1 | |
| α-helix | -21--14 | 8 | |
| β-strand | 218-226 | 9 | 1 |
| β-strand | 232-238 | 7 | 1 |
| α-helix | 250-257 | 8 | |
| α-helix | 258-262 | 5 | |
| β-strand | 267-277 | 11 | 1 |
| α-helix | 278-280 | 3 | |
| α-helix | 281-293 | 13 | |
| β-strand | 297-305 | 9 | 1 |
| α-helix | 312-323 | 12 | |
| α-helix | 326 | 1 | |
| β-strand | 327-330 | 4 | 1 |
| α-helix | 333-343 | 11 | |
| β-strand | 344 | 1 | 2 |
| α-helix | 349-351 | 3 | |
| α-helix | 353-354 | 2 | |
| α-helix | 357-372 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | -28--27 | 2 | 3 |
| α-helix | -24 | 1 | |
| β-strand | -23 | 1 | 4 |
| α-helix | -22 | 1 | |
| α-helix | -21--14 | 8 | |
| β-strand | 218-226 | 9 | 3 |
| β-strand | 232-238 | 7 | 3 |
| β-strand | 241 | 1 | 5 |
| β-strand | 248 | 1 | 5 |
| α-helix | 250-257 | 8 | |
| α-helix | 258-262 | 5 | |
| β-strand | 267-277 | 11 | 3 |
| α-helix | 278-280 | 3 | |
| α-helix | 281-293 | 13 | |
| β-strand | 297-305 | 9 | 3 |
| α-helix | 312-323 | 12 | |
| β-strand | 327-330 | 4 | 3 |
| α-helix | 333-342 | 10 | |
| β-strand | 344 | 1 | 4 |
| α-helix | 349-351 | 3 | |
| α-helix | 353-354 | 2 | |
| α-helix | 357-372 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| APEBEC3F/ssDNA-C9 | A, B | protein | 209 | Homo sapiens | Q8IUX4 (AlphaFold model), Q9HC16 (AlphaFold model) |
| DNA (5'-d(*ap*tp*tp*tp*tp*cp*ap*ap*cp*t)-3') | C | DNA | 10 | DNA-binding vector pODB80 |
>5ZVA_1 APEBEC3F/ssDNA-C9 (chains A, B) MAHHHHHHVDDDDKMLVPRGSENLYFQGSAMDPPTFTFNFNNEPWVRGRHETYLCFTMEV VKHHSPVSWKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECA GEVAEFLARHSNVNLTIFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYCWENFV YNDDEPFKPWKGLKYNFLFLDSKLQEILE
>5ZVA_2 DNA (5'-D(*AP*TP*TP*TP*TP*CP*AP*AP*CP*T)-3') (chains C) ATTTTCAACT
Crystal Structure of Cytidine Deaminase Human APOBEC3F Chimeric Catalytic Domain in Complex with DNA. Cheng, C., Zhang, T., Wang, C. et al. Chin J Chem (2018) 36:1241-1248. DOI 10.1002/cjoc.201800508
Other PDB entries of the same protein (UniProt Q8IUX4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5ZVA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.