2JZH: IIB domain of the mannose transporter of E. coli

Name: PDB 2JZH: structure of IIB domain of the mannose transporter of E. coli
Published: 2008-02-19
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

structure of IIB domain of the mannose transporter of E. coli. Determined by solution NMR. Released 19 Feb 2008.

Method: Solution NMR
Organism: Escherichia coli
Chains: 1
Atoms: 1,281
Mol. weight: 19.12 kDa
Released: 19 Feb 2008

Explore 2JZH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JZH contains 9 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	13-20	8	1
α-helix	28-35	8
β-strand	40-44	5	1
α-helix	46-49	4
α-helix	52-60	9
β-strand	67-71	5	1
α-helix	73-80	8
α-helix	83-85	3
β-strand	89-94	6	1
α-helix	97-105	9
β-strand	112-117	6	1
β-strand	125-126	2	2
β-strand	132-133	2	2
α-helix	135-146	12
β-strand	150-153	4	1
α-helix	160-161	2
β-strand	162-163	2	1
α-helix	164-169	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PTS system mannose-specific EIIAB component	A	protein	173	Escherichia coli	P69797 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JZH_1 PTS system mannose-specific EIIAB component (chains A)
GSMKPMGPNDYMVIGLARIDDRLIHGQVATRWTKETNVSRIIVVSDEVAADTVRKTLLTQ
VAPPGVTAHVVDVAKMIRVYNNPKYAGERVMLLFTNPTDVERLVEGGVKITSVNVGGMAF
RQGKTQVNNAVSVDEKDIEAFKKLNARGIELEVRKVSTDPKLKMMDLISKIDK

Primary citation

Solution NMR Structures of Productive and Non-productive Complexes between the A and B Domains of the Cytoplasmic Subunit of the Mannose Transporter of the Escherichia coli Phosphotransferase System. Hu, J., Hu, K., Williams, D.C. et al. J Biol Chem (2008) 283:11024-11037. DOI 10.1074/jbc.M800312200 · PubMed

Other PDB entries of the same protein (UniProt P69797 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1PDO 1.7 Å, Phosphoenolpyruvate-dependent phosphotransferase system
1VRC Complex of enzyme IIAmannose and the histidine-containing phosphocarrier protein HPr…
1VSQ Solution NMR structure of the productive complex between IIAMannose and IIBMannose of…
2JZN Solution NMR structure of the productive complex between IIAMannose and IIBMannose of…
2JZO Solution NMR structure of the non-productive complex between IIAMannose and IIBMannose…

Browse structure collections

About this viewer

MolViewer shows 2JZH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.