2JZN: PDB entry 2JZN

Name: PDB 2JZN: Solution NMR structure of the productive complex between IIAMannose and IIBMannose of the mannose transporter of the E. coli phosphotransferase system
Published: 2008-02-19
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Solution NMR structure of the productive complex between IIAMannose and IIBMannose of the mannose transporter of the E. coli phosphotransferase system. Determined by solution NMR. Released 19 Feb 2008.

Method: Solution NMR
Organism: Escherichia coli
Chains: 3
Atoms: 3,315
Mol. weight: 47.21 kDa
Released: 19 Feb 2008

Explore 2JZN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JZN contains 19 α-helices and 27 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	1
β-strand	11	1	2
α-helix	13-25	13
β-strand	31-34	4	1
β-strand	36	1	2
β-strand	38	1	3
β-strand	40	1	3
α-helix	42-53	12
β-strand	62-66	5	1
α-helix	72-81	10
β-strand	87-91	5	1
α-helix	95-105	11
α-helix	111-124	14
β-strand	127-128	2	4

Chain C: 9 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	213-220	8	7
α-helix	228-235	8
β-strand	240-244	5	7
α-helix	246-249	4
α-helix	252-260	9
β-strand	267-271	5	7
α-helix	273-280	8
α-helix	283-285	3
β-strand	289-294	6	7
α-helix	297-305	9
β-strand	312-317	6	7
β-strand	325-326	2	8
β-strand	332-333	2	8
α-helix	335-346	12
β-strand	350-353	4	7
α-helix	360-361	2
β-strand	362-363	2	7
α-helix	364-369	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mannose-specific phosphotransferase enzyme IIA component	A, B	protein	133	Escherichia coli	P69797 (AlphaFold model)
Mannose-specific phosphotransferase enzyme IIB component	C	protein	165	Escherichia coli	P69797 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2JZN_1 Mannose-specific phosphotransferase enzyme IIA component (chains A, B)
TIAIVIGTEGWAAEQLLKTAEMLLGEQENVGWIDFVPGENAETLIEKYNAQLAKLDTTKG
VLFLVDTWGGSPFNAASRIVVDKEHYEVIAGVNIPMLVETLMARDDDPSFDELVALAVET
GREGVKALKAKPV

Sequence of entity 2 (C), FASTA

>2JZN_2 Mannose-specific phosphotransferase enzyme IIB component (chains C)
NDYMVIGLARIDDRLIHGQVATRWTKETNVSRIIVVSDEVAADTVRKTLLTQVAPPGVTA
HVVDVAKMIRVYNNPKYAGERVMLLFTNPTDVERLVEGGVKITSVNVGGMAFRQGKTQVN
NAVSVDEKDIEAFKKLNARGIELEVRKVSTDPKLKMMDLISKIDK

Primary citation

Solution NMR Structures of Productive and Non-productive Complexes between the A and B Domains of the Cytoplasmic Subunit of the Mannose Transporter of the Escherichia coli Phosphotransferase System. Hu, J., Hu, K., Williams, D.C. et al. J Biol Chem (2008) 283:11024-11037. DOI 10.1074/jbc.M800312200 · PubMed

Other PDB entries of the same protein (UniProt P69797 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1PDO 1.7 Å, Phosphoenolpyruvate-dependent phosphotransferase system
1VRC Complex of enzyme IIAmannose and the histidine-containing phosphocarrier protein HPr…
1VSQ Solution NMR structure of the productive complex between IIAMannose and IIBMannose of…
2JZH structure of IIB domain of the mannose transporter of E. coli
2JZO Solution NMR structure of the non-productive complex between IIAMannose and IIBMannose…

Browse structure collections

About this viewer

MolViewer shows 2JZN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.