2K1B: Chromo domain of the chromobox protein homolog 7

Solution NMR structure of the chromo domain of the chromobox protein homolog 7. Determined by solution NMR. Released 11 Mar 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 478
Mol. weight: 8.96 kDa
Released: 11 Mar 2008

Explore 2K1B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2K1B contains 2 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	8-15	8	1
β-strand	18-24	7	1
α-helix	30-32	3
β-strand	35-37	3	1
α-helix	44-51	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromobox protein homolog 7	A	protein	73	Homo sapiens	O95931 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2K1B_1 Chromobox protein homolog 7 (chains A)
MHHHHHHSSGRENLYFQGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHIL
DPRLVMAYEEKEE

Primary citation

Solution NMR structure of the chromobox protein homolog 7. Kaustov, L., Lemak, A., Quyang, H. et al. To be published.

Other PDB entries of the same protein (UniProt O95931 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8SII 1.37 Å, Crystal Structure of CBX7 with compound UNC4976
4MN3 1.54 Å, Chromodomain antagonists that target the polycomb-group methyllysine reader protein…
5EPJ 1.6 Å, Crystal Structure of chromodomain of CBX7 in complex with inhibitor UNC3866
6V2R 1.6 Å, Crystal Structure of chromodomain of CBX7 mutant V13A in complex with inhibitor UNC3866
3GS2 1.7 Å, Ring1B C-terminal domain/Cbx7 Cbox Complex
9V9P 3.4 Å, Cryo-EM structure of the cPRC1-di-nucleosome (CBX7) complex
2L12 Solution NMR structure of the chromobox protein 7 with H3K9me3
2L1B Solution NMR structure of the chromobox protein Cbx7 with H3K27me3

Browse structure collections

About this viewer

MolViewer shows 2K1B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.