2K2R: Alpha-parvin CH2/paxillin LD1 complex

The NMR structure of alpha-parvin CH2/paxillin LD1 complex. Determined by solution NMR. Released 27 May 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,136
Mol. weight: 16.1 kDa
Released: 27 May 2008

Explore 2K2R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2K2R contains 8 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	6-13	8
α-helix	15-36	22
α-helix	43-46	4
α-helix	51-61	11
α-helix	77-94	18
α-helix	103-107	5
α-helix	112-125	14

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-9	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-parvin	A	protein	129	Homo sapiens	Q9NVD7 (AlphaFold model)
Paxillin	B	protein	10		P49023 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2K2R_1 Alpha-parvin (chains A)
RHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLL
EGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYN
LFTKYRNVE

Sequence of entity 2 (B), FASTA

>2K2R_2 Paxillin (chains B)
DLDALLADLE

Primary citation

The Structure of {alpha}-Parvin CH2-Paxillin LD1 Complex Reveals a Novel Modular Recognition for Focal Adhesion Assembly. Wang, X., Fukuda, K., Byeon, I.J. et al. J Biol Chem (2008) 283:21113-21119. DOI 10.1074/jbc.M801270200 · PubMed

Other PDB entries of the same protein (UniProt Q9NVD7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2VZC 1.05 Å, Crystal structure of the C-terminal calponin homology domain of alpha parvin
9TP9 1.45 Å, Crystal structure of integrin-linked kinase (ILK) in complex with Alpha-Parvin and…
9D5E 1.5 Å, Crystal structure of the ILK/alpha-parvin core complex bound to gefitinib
9D5F 1.5 Å, Crystal structure of the ILK/alpha-parvin core complex bound to bosutinib
9D5H 1.5 Å, Crystal structure of the ILK mutant (R371Q)/alpha-parvin core complex bound to gefitinib
9D5I 1.5 Å, Crystal structure of the ILK mutant (R225A)/alpha-parvin core complex bound to MgATP
9D5P 1.5 Å, Crystal structure of the ILK/alpha-parvin core complex bound to erlotinib
9TPD 1.5 Å, Crystal structure of integrin-linked kinase (ILK) in complex with alpha-parvin and a…
9D5G 1.55 Å, Crystal structure of the ILK/alpha-parvin core complex bound to 4-methyl erlotinib
2VZG 1.8 Å, Crystal structure of the C-terminal calponin homology domain of alpha- parvin in complex…
3KMU 1.8 Å, Crystal structure of the ILK/alpha-parvin core complex (apo)
3REP 1.8 Å, Crystal structure of the ILK/alpha-parvin core complex (MnATP)

Browse structure collections

About this viewer

MolViewer shows 2K2R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.