2K3S: Smoothelin-like protein 1

HADDOCK-derived structure of the CH-domain of the smoothelin-like 1 complexed with the C-domain of apocalmodulin. Determined by solution NMR. Released 27 May 2008.

Method: Solution NMR
Organisms: Mus musculus, Xenopus laevis
Chains: 2
Atoms: 1,500
Mol. weight: 21.43 kDa
Released: 27 May 2008

Explore 2K3S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2K3S contains 12 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	5-17	13
α-helix	30-32	3
α-helix	36-45	10
α-helix	52-54	3
α-helix	57-59	3
α-helix	60-75	16
α-helix	83-89	7
α-helix	94-110	17

Chain B: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	83-92	10
β-strand	99-100	2	1
α-helix	102-111	10
α-helix	118-126	9
β-strand	136-137	2	1
α-helix	138-147	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Smoothelin-like protein 1	A	protein	119	Mus musculus	Q99LM3 (AlphaFold model)
Calmodulin	B	protein	67	Xenopus laevis	P0DP33 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2K3S_1 Smoothelin-like protein 1 (chains A)
GPLGSKNMLLEWCRAMTRNYEHVDIQNFSSSWSSGMAFCALIHKFFPEAFDYAELDPAKR
RHNFTLAFSTAEKLADCAQLLEVDDMVRLAVPDSKCVYTYIQELYRSLVQKGLVKTKKK

Sequence of entity 2 (B), FASTA

>2K3S_2 Calmodulin (chains B)
EEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEF
VQMMTAK

Primary citation

Solution structure of the calponin homology (CH) domain from the smoothelin-like 1 protein: a unique apocalmodulin-binding mode and the possible role of the C-terminal type-2 CH-domain in smooth muscle relaxation. Ishida, H., Borman, M.A., Ostrander, J. et al. J Biol Chem (2008) 283:20569-20578. DOI 10.1074/jbc.M800627200 · PubMed

Other PDB entries of the same protein (UniProt Q99LM3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2JV9 The Solution Structure of Calponin Homology Domain from Smoothelin-like 1

Browse structure collections

About this viewer

MolViewer shows 2K3S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.