2K3U: Tyrosine-sulfated C5a receptor N-terminus

Structure of the tyrosine-sulfated C5a receptor N-terminus in complex with the immune evasion protein CHIPS. Determined by solution NMR. Released 10 Mar 2009.

Method: Solution NMR
Organisms: Staphylococcus aureus subsp. aureus str. Newman, Homo sapiens
Chains: 2
Atoms: 927
Mol. weight: 13.19 kDa
Released: 10 Mar 2009

Explore 2K3U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2K3U contains 5 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	37	1	1
α-helix	38-52	15
β-strand	59-65	7	2
β-strand	71-75	5	2
α-helix	79-81	3
α-helix	82-85	4
α-helix	87	1
β-strand	88	1	1
α-helix	89	1
β-strand	95-100	6	2
β-strand	105	1	3
β-strand	108-111	4	2

Chain B: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	13-14	2	2
β-strand	21	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chemotaxis inhibitory protein	A	protein	91	Staphylococcus aureus subsp. aureus str. Newman	A6QIG7 (AlphaFold model)
C5a anaphylatoxin chemotactic receptor 1	B	protein	24	Homo sapiens	P21730 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2K3U_1 Chemotaxis inhibitory protein (chains A)
NSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELL
GKMYKTYFFKKGESKSSYVINGPGKTNEYAY

Sequence of entity 2 (B), FASTA

>2K3U_2 C5a anaphylatoxin chemotactic receptor 1 (chains B)
XTTPDYGHYDDKDTLDLNTPVDKX

Primary citation

Structure of the Tyrosine-sulfated C5a Receptor N Terminus in Complex with Chemotaxis Inhibitory Protein of Staphylococcus aureus. Ippel, J.H., de Haas, C.J., Bunschoten, A. et al. J Biol Chem (2009) 284:12363-12372. DOI 10.1074/jbc.M808179200 · PubMed

Other PDB entries of the same protein (UniProt A6QIG7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1XEE Solution structure of the Chemotaxis Inhibitory Protein of Staphylococcus aureus

Browse structure collections

About this viewer

MolViewer shows 2K3U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.