2K42: GTPase Binding Domain of WASP

Solution Structure of the GTPase Binding Domain of WASP in Complex with EspFU, an EHEC Effector. Determined by solution NMR. Released 22 Jul 2008.

Method: Solution NMR
Organisms: Homo sapiens, Escherichia coli O157:H7
Chains: 2
Atoms: 857
Mol. weight: 12.2 kDa
Released: 22 Jul 2008

Explore 2K42 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2K42 contains 6 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	14-15	2	1
β-strand	19-20	2	1
α-helix	27-36	10
α-helix	40-43	4
α-helix	46-58	13
α-helix	62-69	8

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	79-88	10
α-helix	92-94	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Wiskott-Aldrich syndrome protein	A	protein	72	Homo sapiens	P42768 (AlphaFold model)
Espfu	B	protein	36	Escherichia coli O157:H7	Q8X482

Sequence of entity 1 (A), FASTA

>2K42_1 Wiskott-Aldrich syndrome protein (chains A)
GHMSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQG
GLEAVRQEMRRQ

Sequence of entity 2 (B), FASTA

>2K42_2 ESPFU (chains B)
GHMLPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNW

Primary citation

Structural mechanism of WASP activation by the enterohaemorrhagic E. coli effector EspF(U). Cheng, H.C., Skehan, B.M., Campellone, K.G. et al. Nature (2008) 454:1009-1013. DOI 10.1038/nature07160 · PubMed

Other PDB entries of the same protein (UniProt P42768 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OT0 2.05 Å, Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with a C-terminal…
2A3Z 2.08 Å, Ternary complex of the WH2 domain of WASP with Actin-DNAse I
1CEE Solution structure of CDC42 in complex with the gtpase binding domain of wasp
1EJ5 Solution structure of the autoinhibited conformation of wasp
1T84 Solution structure of the Wiskott-Aldrich Syndrome Protein (WASP) autoinhibited core…
9S9X Human WASP/WIP complex

Browse structure collections

About this viewer

MolViewer shows 2K42 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.