2K48: Nucleoprotein

NMR Structure of the N-terminal Coiled Coil Domain of the Andes Hantavirus Nucleocapsid Protein. Determined by solution NMR. Released 5 Aug 2008.

Method: Solution NMR
Organism: Andes virus
Chains: 1
Atoms: 848
Mol. weight: 12.07 kDa
Released: 5 Aug 2008

Explore 2K48 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2K48 contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	10-12	3
α-helix	32-67	36
α-helix	71-105	35

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleoprotein	A	protein	107	Andes virus	P11207 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2K48_1 Nucleoprotein (chains A)
MHHHHHHGKPIPNPLLGLDSTENLYFQGIDPFTMSTLQELQENITAHEQQLVTARQKLKD
AEKAVEVDPDDVNKSTLQNRRAAVSTLETKLGELKRQLADLVAAQKL

Primary citation

NMR Structure of the N-terminal Coiled Coil Domain of the Andes Hantavirus Nucleocapsid Protein. Wang, Y., Boudreaux, D.M., Estrada, D.F. et al. J Biol Chem (2008) 283:28297-28304. DOI 10.1074/jbc.M804869200 · PubMed

Other PDB entries of the same protein (UniProt P11207 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4I1S 2.29 Å, Melanoma differentiation associated protein-5 Helicase domain complex with inhibitor…
2B5L 2.85 Å, Crystal Structure of DDB1 In Complex with Simian Virus 5 V Protein
2HYE 3.1 Å, Crystal Structure of the DDB1-Cul4A-Rbx1-SV5V Complex

Browse structure collections

About this viewer

MolViewer shows 2K48 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.