2K7L: CentFCP1-T584PO4 peptide

NMR structure of a complex formed by the C-terminal domain of human RAP74 and a phosphorylated peptide from the central domain of the FCP1. Determined by solution NMR. Released 2 Jun 2009.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 719
Mol. weight: 10.3 kDa
Released: 2 Jun 2009

Explore 2K7L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2K7L contains 6 α-helices and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	456-465	10
β-strand	468	1	1
α-helix	470-477	8
α-helix	479-482	4
α-helix	488-491	4
α-helix	493-500	8
β-strand	503-507	5	1
β-strand	510-514	5	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	586-598	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
centFCP1-T584PO4 peptide	B	protein	19		Q9Y5B0 (AlphaFold model)
General transcription factor IIF subunit 1	A	protein	67	Homo sapiens	P35269 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>2K7L_1 centFCP1-T584PO4 peptide (chains B)
EDTDEDDHLIYLEEILVRV

Sequence of entity 2 (A), FASTA

>2K7L_2 General transcription factor IIF subunit 1 (chains A)
DVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDK
MHFSLKE

Primary citation

NMR structure of a complex formed by the carboxyl-terminal domain of human RAP74 and a phosphorylated peptide from the central domain of the FCP1 phosphatase. Yang, A., Abbott, K.L., Desjardins, A. et al. Biochemistry (2009) 48:1964-1974. DOI 10.1021/bi801549m · PubMed

Other PDB entries of the same protein (UniProt Q9Y5B0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1J2X 2.0 Å, Crystal structure of RAP74 C-terminal domain complexed with FCP1 C-terminal peptide
1ONV NMR Structure of a Complex Containing the TFIIF Subunit RAP74 and the RNAP II CTD…

Browse structure collections

About this viewer

MolViewer shows 2K7L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.