2K9A: Arl2 Effector, BART

Name: PDB 2K9A: The Solution Structure of the Arl2 Effector, BART
Published: 2008-11-11
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: protein binding

The Solution Structure of the Arl2 Effector, BART. Determined by solution NMR. Released 11 Nov 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,129
Mol. weight: 16.16 kDa
Released: 11 Nov 2008

Explore 2K9A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2K9A contains 9 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	19-32	14
α-helix	35-51	17
α-helix	62-69	8
α-helix	70-74	5
α-helix	75-82	8
α-helix	90-100	11
α-helix	106-112	7
α-helix	113-115	3
α-helix	118-132	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ADP-ribosylation factor-like protein 2-binding protein	A	protein	137	Homo sapiens	Q9Y2Y0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2K9A_1 ADP-ribosylation factor-like protein 2-binding protein (chains A)
HMDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENK
LIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFL
AFKEMFLDYRAEKEGRG

Primary citation

The Structure of Binder of Arl2 (BART) Reveals a Novel G Protein Binding Domain: IMPLICATIONS FOR FUNCTION. Bailey, L.K., Campbell, L.J., Evetts, K.A. et al. J Biol Chem (2009) 284:992-999. DOI 10.1074/jbc.M806167200 · PubMed

Other PDB entries of the same protein (UniProt Q9Y2Y0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3DOE 2.25 Å, Complex of ARL2 and BART, Crystal Form 1
3DOF 3.3 Å, Complex of ARL2 and BART, Crystal Form 2

Browse structure collections

About this viewer

MolViewer shows 2K9A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.