3DOE: Complex of ARL2 and BART, Crystal Form 1

Complex of ARL2 and BART, Crystal Form 1. Determined by X-ray diffraction at 2.25 Å resolution. Released 3 Mar 2009.

Method: X-ray diffraction
Resolution: 2.25 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,622
Mol. weight: 41.5 kDa
Ligands: GTP, MG
Released: 3 Mar 2009

Explore 3DOE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3DOE contains 18 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	3-9	7
β-strand	16-22	7	1
α-helix	29-37	9
β-strand	50-54	5	1
β-strand	57	1	2
β-strand	60	1	2
β-strand	61-67	7	1
α-helix	71-80	10
β-strand	86-92	7	1
α-helix	96-98	3
α-helix	99-110	12
α-helix	113-115	3
β-strand	119-125	7	1
α-helix	132-134	3
α-helix	135-140	6
α-helix	141-146	6
β-strand	152-156	5	1
β-strand	158	1	3
β-strand	163	1	3
α-helix	165-189	25

Chain B: 8 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	20-32	13
α-helix	36-48	13
α-helix	49-51	3
β-strand	58	1	1
α-helix	59	1
α-helix	62-84	23
α-helix	90-97	8
α-helix	109-114	6
α-helix	118-132	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ADP-ribosylation factor-like protein 2	A	protein	192	Homo sapiens	P36404 (AlphaFold model)
ADP-ribosylation factor-like protein 2-binding protein	B	protein	165	Homo sapiens	Q9Y2Y0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3DOE_1 ADP-ribosylation factor-like protein 2 (chains A)
MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGF
KLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATL
LIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRI
FTADLEHHHHHH

Sequence of entity 2 (B), FASTA

>3DOE_2 ADP-ribosylation factor-like protein 2-binding protein (chains B)
GSMDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEEN
KLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDF
LAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH

Ligands and cofactors

ID	Name	Formula	Copies
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	1
MG	Magnesium ion	Mg	1

Primary citation

Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector. Zhang, T., Li, S., Zhang, Y. et al. Structure (2009) 17:602-610. DOI 10.1016/j.str.2009.01.014 · PubMed

Other PDB entries of the same protein (UniProt P36404 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9M1J 2.14 Å, Cryo-EM structure of the TBC-DE-Arl2-beta-tubulin complex
9M1M 2.21 Å, Cryo-EM structure of the TBC-DEC-Arl2-alpha-beta-tubulin complex with GDP-AlFx
9M1N 2.24 Å, Cryo-EM structure of the TBC-DC-Arl2-alpha-beta-tubulin complex with GDP-AlFx
9M1K 2.45 Å, Cryo-EM structure of the TBC-DE-Arl2-beta-tubulin complex with GTP
9M1I 2.48 Å, Cryo-EM structure of the TBC-D-Arl2-beta-tubulin complex
9M1L 2.55 Å, Cryo-EM structure of the TBC-DE-Arl2-alpha-beta-tubulin complex with GTP
3DOF 3.3 Å, Complex of ARL2 and BART, Crystal Form 2

Browse structure collections

About this viewer

MolViewer shows 3DOE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.