2KDD: Borealin

Solution structure of the conserved C-terminal dimerization domain of Borealin. Determined by solution NMR. Released 30 Jun 2009.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 872
Mol. weight: 16.16 kDa
Released: 30 Jun 2009

Explore 2KDD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KDD contains 6 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	228-229	2	1
α-helix	238-239	2
β-strand	241-242	2	1
α-helix	248-252	5
α-helix	256-275	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Borealin	A, B	protein	76	Homo sapiens	Q53HL2 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2KDD_1 Borealin (chains A, B)
GSAGERIYNISGNGSPLADSKEIFLTVPVGGGESLRLLASDLQRHSIAQLDPEALGNIKK
LSNRLAQICSSIRTHK

Primary citation

Phosphorylation of a borealin dimerization domain is required for proper chromosome segregation. Bourhis, E., Lingel, A., Phung, Q. et al. Biochemistry (2009) 48:6783-6793. DOI 10.1021/bi900530v · PubMed

Other PDB entries of the same protein (UniProt Q53HL2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QFA 1.4 Å, Crystal structure of a Survivin-Borealin-INCENP core complex
6YIF 1.81 Å, Structure of Chromosomal Passenger Complex (CPC) bound to phosphorylated Histone 3…
9D41 1.84 Å, Crystal structure of N-terminal domain of Borealin (20-88) in complex with synthetic…
8RUQ 2.29 Å, Borealin N-terminus in complex with H3.T3p-nucleosome
2RAW 2.4 Å, Crystal structure of the Borealin-Survivin complex
8RUP 2.42 Å, Chromosome Passenger Complex (CPC) localization module in complex with H3.T3p-nucleosome
6YIH 2.55 Å, Structure of Chromosomal Passenger Complex (CPC) bound to phosphorylated Histone 3…
7U5V 2.59 Å, Crystal structure of the Mixed Lineage Leukaemia (MLL1) SET Domain with the cofactor…
9SI3 2.83 Å, Chromosomal Passenger Complex in complex with H3T3ph Nucleosome
9SJ5 2.85 Å, Chromosomal Passenger Complex in complex with H3T3ph Nucleosome (Class1)
9SI9 2.86 Å, Chromosomal Passenger Complex in complex with H3T3ph Nucleosome (Class0)
2RAX 3.3 Å, Crystal structure of Borealin (20-78) bound to Survivin (1-120)

Browse structure collections

About this viewer

MolViewer shows 2KDD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.